Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02424 |
NCBI Accession ID | |
Organism | Lachnoanaerobaculum |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGACAAATACATCTATACCGCTGGCTGTTGCCACAATGACTAGAGAGAAGCTCGATGAAGAACTTAAGAAACGTTATGATTCCATCAATGCAAGAATGGTATATTCTGTAGATGAAGTCGATATCTTACTTGTAAAATAA |
Sequence | MTNTSIPLAVATMTREKLDEELKKRYDSINARMVYSVDEVDILLVK |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2006194 | 2006310 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
2 | 1881156 | 1881272 | - | NZ_AP019309.1 | Intestinibaculum porci |
3 | 2806638 | 2806754 | - | NZ_AP019309.1 | Intestinibaculum porci |
4 | 1586932 | 1587048 | + | NZ_LR699011.1 | Roseburia hominis |
5 | 2591770 | 2591886 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05016.17 | 1.0 | 4 | -3 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |