Result : EXP02424
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02424 |
| NCBI Accession ID | |
| Organism | Lachnoanaerobaculum |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGACAAATACATCTATACCGCTGGCTGTTGCCACAATGACTAGAGAGAAGCTCGATGAAGAACTTAAGAAACGTTATGATTCCATCAATGCAAGAATGGTATATTCTGTAGATGAAGTCGATATCTTACTTGTAAAATAA |
| Sequence | MTNTSIPLAVATMTREKLDEELKKRYDSINARMVYSVDEVDILLVK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2006194 | 2006310 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 2 | 1881156 | 1881272 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 3 | 2806638 | 2806754 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 4 | 1586932 | 1587048 | + | NZ_LR699011.1 | Roseburia hominis |
| 5 | 2591770 | 2591886 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027002.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 1.0 | 4 | -3 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |
++ More..