Result : EXP02423
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02423 |
| NCBI Accession ID | |
| Organism | Coprococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGGGAGTGCCATGAAAAAGATGTGTGGTTTTGTCCTGTTCTGGATAGCTGCAGGCATGACCATTATGATGTTTGTCAATTCCTGTGTATTAGGCATCTGCCTGATTATATTTTGTCTTATTTTGGCTTATAATCTGTTCTGTTCAAAATAA |
| Sequence | MGSAMKKMCGFVLFWIAAGMTIMMFVNSCVLGICLIIFCLILAYNLFCSK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4143621 | 4143770 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 2 | 3684690 | 3684827 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 3 | 3550953 | 3551081 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 4 | 1778013 | 1778141 | + | NZ_LN879430.1 | Herbinix luporum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048000.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00271.33 | 0.75 | 3 | 2674 | opposite-strand | Helicase conserved C-terminal domain |
| 2 | PF17191.6 | 0.75 | 3 | 2674 | opposite-strand | RecG wedge domain |
| 3 | PF00270.31 | 0.75 | 3 | 2674 | opposite-strand | DEAD/DEAH box helicase |
| 4 | PF04851.17 | 0.75 | 3 | 2674 | opposite-strand | Type III restriction enzyme, res subunit |
| 5 | PF13684.8 | 1.0 | 4 | 646.0 | opposite-strand | Dihydroxyacetone kinase family |
| 6 | PF02734.19 | 1.0 | 4 | 646.0 | opposite-strand | DAK2 domain |
| 7 | PF03780.15 | 1.0 | 4 | 256.0 | opposite-strand | Asp23 family, cell envelope-related function |
| 8 | PF00830.21 | 1.0 | 4 | 135.5 | opposite-strand | Ribosomal L28 family |
| 9 | PF09579.12 | 1.0 | 4 | 507.5 | opposite-strand | Sporulation protein YtfJ (Spore YtfJ) |
| 10 | PF11167.10 | 1.0 | 4 | 919.0 | opposite-strand | Protein of unknown function (DUF2953) |
++ More..