Result : EXP02415
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02415 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAGGTGATAAAAAAGGACTTTCTTTTTTACGTATCAACGGCCAATATAAGCTTGAATTTCGGGAAATAGCTAATGCGGGTAATCAAGCAGTCATAGAGATATGCTCTTTGGTGGATATTACAAATCATTATAAATAG |
| Sequence | MKGDKKGLSFLRINGQYKLEFREIANAGNQAVIEICSLVDITNHYK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2939354 | 2939494 | + | NZ_LT906459.1 | Odoribacter splanchnicus |
| 2 | 3331763 | 3331903 | + | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 3 | 475749 | 475889 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 4 | 2604949 | 2605089 | + | NZ_LR699004.1 | Phocaeicola dorei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906459.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 1.0 | 4 | 7.5 | same-strand | Helix-turn-helix |
++ More..