Result : EXP02386
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02386 |
| NCBI Accession ID | |
| Organism | Pseudoflavonifractor,Eubacterium,Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAACCAAAATGCAAAATCTGATCCGGACGCTTTTGTGCAGTACTGCAAGTCTGGCACTGTTGCTGGCAGTGAACAGTGTGTCCAACACTTGTTGCTTCCTGTCTTACCAGCCGGATGTTCCCGAGGAGTTGCTGTGA |
| Sequence | MKTKMQNLIRTLLCSTASLALLLAVNSVSNTCCFLSYQPDVPEELL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl27940. Profile Description: Staphylococcal AgrD protein. Members of this family of short peptides are precursors to thiolactone (unless Cys is replaced by Ser) cyclic autoinducer peptides, used in quorum-sensing systems in Gram-positive bacteria. The best characterized is the AgrD precursor, processed by the AgrB protein. Nearby proteins regularly encountered include a histidine kinase and a response regulator. This model is related to pfam05931 but is newer and currently broader in scope. |
| Pubmed ID | 32601270 |
| Domain | CDD:391800 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2912696 | 2912842 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 2 | 1910348 | 1910470 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 3 | 2931126 | 2931248 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015589.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04397.17 | 0.67 | 2 | 1600.5 | both-strands | LytTr DNA-binding domain |
| 2 | PF00072.26 | 0.67 | 2 | 1600.5 | both-strands | Response regulator receiver domain |
| 3 | PF04647.17 | 1.0 | 3 | 22 | same-strand | Accessory gene regulator B |
| 4 | PF02518.28 | 0.67 | 2 | 591.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 5 | PF14689.8 | 0.67 | 2 | 591.5 | same-strand | Sensor kinase SpoOB-type, alpha-helical domain |
| 6 | PF14501.8 | 0.67 | 2 | 591.5 | same-strand | GHKL domain |
++ More..