Result : B4U746
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP001130.1 |
| Organism | Hydrogenobaculum sp. (strain Y04AAS1) |
| Left | 242183 |
| Right | 242482 |
| Strand | + |
| Nucleotide Sequence | ATGAGAGCACCTGAGGAAGTTATTATACGTCCTATAATCACTGAAAAGACAAATAGATTGATGGAAGATTTAAATAAGTATGTATTTGAAGTTCACAAAGATGCTAACAAACATGAAATAAAGCATGCTGTGGAAAAGCTGTTTGGAGTAAAAGTGAAAGCTGTTAACACTCTTTATGCAAGACCAAGGGTAAAAAGGACAATAACAAGAAGAGGCAGAGTTTACGGTGCCACAAGAGGTTATAAGAAGGCCATTATTACCCTTGATAAGAATTCAAAAATAGATTTTATGAGCTTGTGA |
| Sequence | MRAPEEVIIRPIITEKTNRLMEDLNKYVFEVHKDANKHEIKHAVEKLFGVKVKAVNTLYARPRVKRTITRRGRVYGATRGYKKAIITLDKNSKIDFMSL |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 19136599 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B4U746 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 171
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5056 | 5301 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 2 | 585518 | 585814 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 3 | 1326853 | 1327149 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 4 | 6012330 | 6012629 | + | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
| 5 | 2979380 | 2979634 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 6 | 944135 | 944380 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 7 | 471240 | 471536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 8 | 2496256 | 2496546 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 9 | 788129 | 788425 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 10 | 2936476 | 2936760 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 11 | 449676 | 449942 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 12 | 1223454 | 1223729 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 13 | 2951911 | 2952201 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 14 | 2285755 | 2286045 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 15 | 241292 | 241579 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 16 | 221369 | 221650 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 17 | 1693289 | 1693543 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 18 | 809737 | 810009 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 19 | 1554249 | 1554491 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 20 | 728698 | 729000 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 21 | 2022490 | 2022792 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 22 | 974992 | 975234 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 23 | 1216012 | 1216254 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 24 | 1813024 | 1813266 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 25 | 1003683 | 1003925 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 26 | 2403800 | 2404042 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 27 | 1869840 | 1870142 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 28 | 2597336 | 2597632 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 29 | 215256 | 215546 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 30 | 2323394 | 2323684 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 31 | 4690671 | 4690964 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 32 | 5297740 | 5298033 | - | NZ_CP009288.1 | Paenibacillus durus |
| 33 | 2775225 | 2775497 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 34 | 129284 | 129574 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 35 | 990059 | 990364 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 36 | 3077390 | 3077677 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 37 | 9028635 | 9028931 | - | NZ_CP016211.1 | Minicystis rosea |
| 38 | 1237131 | 1237436 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 39 | 359432 | 359731 | - | NZ_LS974202.1 | Mesotoga infera |
| 40 | 4388004 | 4388297 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 41 | 784320 | 784610 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 42 | 1810892 | 1811185 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 43 | 3450598 | 3450888 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 44 | 731547 | 731804 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 45 | 4489763 | 4490050 | + | NZ_CP021235.1 | Pontibacter actiniarum |
| 46 | 3622926 | 3623216 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 47 | 267500 | 267802 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 48 | 1535465 | 1535755 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 49 | 1825868 | 1826161 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 50 | 129110 | 129400 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 51 | 661762 | 662052 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 52 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 53 | 692461 | 692754 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 54 | 3634291 | 3634584 | - | NZ_CP033433.1 | Cohnella candidum |
| 55 | 288223 | 288513 | - | NZ_CP026363.1 | Brevibacillus agri |
| 56 | 3953468 | 3953758 | - | NZ_CP019870.1 | Clostridioides difficile |
| 57 | 3983708 | 3984001 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 58 | 268473 | 268763 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 59 | 1555722 | 1556000 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 60 | 2512468 | 2512710 | + | NZ_CP014766.1 | Pontibacter akesuensis |
| 61 | 1448892 | 1449140 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 62 | 874574 | 874873 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 63 | 984171 | 984443 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 64 | 4059948 | 4060208 | - | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 65 | 2809112 | 2809354 | - | NZ_CP048106.1 | Pontibacter pudoricolor |
| 66 | 5702114 | 5702404 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 67 | 1491052 | 1491300 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 68 | 938223 | 938516 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 69 | 322922 | 323215 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 70 | 2582964 | 2583263 | + | NZ_CP034438.1 | Flaviflexus salsibiostraticola |
| 71 | 919840 | 920085 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 72 | 1635648 | 1635938 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 73 | 1124693 | 1124962 | - | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 74 | 1914245 | 1914532 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 75 | 1318110 | 1318412 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 76 | 1781314 | 1781583 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 77 | 3264253 | 3264516 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 78 | 1327527 | 1327829 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 79 | 1303923 | 1304225 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 80 | 85534 | 85836 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 81 | 1532284 | 1532553 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 82 | 1222271 | 1222516 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 83 | 647296 | 647565 | - | NZ_CP024422.1 | Paracoccus yeei |
| 84 | 275573 | 275833 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 85 | 1275776 | 1276057 | + | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 86 | 1666524 | 1666793 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 87 | 11106390 | 11106689 | - | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 88 | 1973086 | 1973328 | + | NZ_CP009621.1 | Pontibacter korlensis |
| 89 | 400162 | 400425 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 90 | 648217 | 648474 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 91 | 641523 | 641786 | + | NZ_CP016353.1 | Prauserella marina |
| 92 | 2808126 | 2808395 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 93 | 2764652 | 2764915 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 94 | 1984857 | 1985120 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 95 | 10122 | 10385 | - | NZ_CP059694.1 | Gordonia rubripertincta |
| 96 | 3519977 | 3520237 | - | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 97 | 336471 | 336713 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 98 | 128034 | 128303 | + | NZ_CP032125.1 | Profundibacter amoris |
| 99 | 1801019 | 1801288 | - | NZ_CP045072.1 | Paracoccus kondratievae |
| 100 | 1134479 | 1134775 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 101 | 236814 | 237101 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 102 | 1457211 | 1457465 | - | NZ_CP054836.1 | Oricola thermophila |
| 103 | 5331767 | 5332030 | + | NZ_CP033972.1 | Gordonia insulae |
| 104 | 2174185 | 2174427 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 105 | 1456203 | 1456460 | - | NZ_CP041146.1 | Nocardioides humi |
| 106 | 757741 | 758037 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 107 | 1933396 | 1933665 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 108 | 1842343 | 1842597 | + | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 109 | 2468473 | 2468775 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 110 | 5535098 | 5535358 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 111 | 2547717 | 2547986 | + | NZ_CP032509.1 | Georhizobium profundi |
| 112 | 1533147 | 1533416 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 113 | 1000738 | 1001040 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 114 | 1522677 | 1522946 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 115 | 3196153 | 3196422 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 116 | 1734517 | 1734786 | + | NZ_CP020906.1 | Rhizobium etli |
| 117 | 1738311 | 1738580 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 118 | 2632256 | 2632525 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 119 | 1782826 | 1783095 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 120 | 1783815 | 1784084 | + | NZ_CP071604.1 | Rhizobium binae |
| 121 | 3614832 | 3615101 | + | NZ_CP071454.1 | Rhizobium lentis |
| 122 | 1778813 | 1779082 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 123 | 1349248 | 1349517 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 124 | 785086 | 785355 | - | NZ_CP054021.1 | Rhizobium indicum |
| 125 | 2015758 | 2016027 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 126 | 1443037 | 1443306 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 127 | 788971 | 789240 | + | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 128 | 4039966 | 4040235 | - | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 129 | 274358 | 274627 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 130 | 4354252 | 4354521 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 131 | 1583423 | 1583692 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 132 | 248037 | 248306 | + | NZ_CP012160.1 | Octadecabacter temperatus |
| 133 | 220535 | 220777 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 134 | 5035406 | 5035660 | - | NZ_CP017147.1 | Bosea vaviloviae |
| 135 | 1156579 | 1156875 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 136 | 1717823 | 1718071 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 137 | 1480372 | 1480635 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 138 | 1197666 | 1197935 | - | NC_010103.1 | Brucella canis ATCC 23365 |
| 139 | 1198776 | 1199045 | - | NC_004310.3 | Brucella suis 1330 |
| 140 | 1204564 | 1204833 | - | NC_009505.1 | Brucella ovis ATCC 25840 |
| 141 | 1205091 | 1205360 | - | NC_013119.1 | Brucella microti CCM 4915 |
| 142 | 788961 | 789230 | + | NC_022905.1 | Brucella ceti TE10759-12 |
| 143 | 1507736 | 1508005 | + | NZ_LT605585.1 | Brucella inopinata |
| 144 | 1127009 | 1127278 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 145 | 1782333 | 1782581 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 146 | 1762919 | 1763167 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 147 | 1164507 | 1164770 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 148 | 196097 | 196366 | + | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 149 | 2929839 | 2930108 | - | NZ_CP041159.1 | Leisingera aquaemixtae |
| 150 | 1501216 | 1501479 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 151 | 1287803 | 1288066 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 152 | 1268009 | 1268278 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 153 | 1103024 | 1103287 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 154 | 1304850 | 1305128 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 155 | 2870991 | 2871260 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 156 | 1147592 | 1147861 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 157 | 451309 | 451557 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 158 | 3439202 | 3439471 | + | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 159 | 108156 | 108404 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 160 | 249118 | 249414 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 161 | 6464847 | 6465161 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 162 | 1835702 | 1835950 | - | NZ_LT906439.1 | Streptococcus merionis |
| 163 | 5624361 | 5624603 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 164 | 6145230 | 6145472 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 165 | 1487083 | 1487331 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 166 | 72789 | 73037 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 167 | 871382 | 871630 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 168 | 166112 | 166396 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 169 | 1533966 | 1534229 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 170 | 3996838 | 3997080 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 171 | 5465402 | 5465644 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013894.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 0.68 | 117 | 2769.0 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF03764.20 | 0.63 | 108 | 3090.0 | same-strand | Elongation factor G, domain IV |
| 3 | PF14492.8 | 0.63 | 108 | 3090.0 | same-strand | Elongation Factor G, domain III |
| 4 | PF00679.26 | 0.63 | 108 | 3090.0 | same-strand | Elongation factor G C-terminus |
| 5 | PF03144.27 | 0.68 | 117 | 2769.0 | same-strand | Elongation factor Tu domain 2 |
| 6 | PF03143.19 | 0.64 | 109 | 1885 | same-strand | Elongation factor Tu C-terminal domain |
| 7 | PF01926.25 | 0.64 | 109 | 1943.0 | same-strand | 50S ribosome-binding GTPase |
| 8 | PF00338.24 | 0.95 | 163 | 1357 | same-strand | Ribosomal protein S10p/S20e |
| 9 | PF00573.24 | 1.0 | 171 | 21 | same-strand | Ribosomal protein L4/L1 family |
| 10 | PF03947.20 | 0.96 | 165 | 23 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 11 | PF00181.25 | 0.97 | 166 | 24.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 12 | PF00203.23 | 0.96 | 165 | 886 | same-strand | Ribosomal protein S19 |
| 13 | PF00189.22 | 0.95 | 162 | 1584.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 14 | PF07650.19 | 0.95 | 162 | 1584.0 | same-strand | KH domain |
| 15 | PF00252.20 | 0.94 | 160 | 2302.0 | same-strand | Ribosomal protein L16p/L10e |
| 16 | PF00237.21 | 0.95 | 162 | 1177.0 | same-strand | Ribosomal protein L22p/L17e |
++ More..