Result : B4U714
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP001130.1 |
| Organism | Hydrogenobaculum sp. (strain Y04AAS1) |
| Left | 209539 |
| Right | 209721 |
| Strand | + |
| Nucleotide Sequence | ATGGCGGTACCAAAGCGTAGGACTTCTCGTTGGAGAAGAAACCAAAGAAGGGCGCAAGCTTTTTTTGCGAAGCTAAAATCTTTTAATATGGTAAAATGTCCAAATTGTGGAGAATTTGCAATGCCACACAGGGCTTGTCCTTACTGCGGTTATTACAGAGATAAACAAGTATTAGAAGTGTAA |
| Sequence | MAVPKRRTSRWRRNQRRAQAFFAKLKSFNMVKCPNCGEFAMPHRACPYCGYYRDKQVLEV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19136599 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B4U714 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 140
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1402720 | 1402905 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 2 | 845128 | 845313 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 3 | 739028 | 739213 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 4 | 770235 | 770426 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 5 | 1206868 | 1207050 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 6 | 1367078 | 1367257 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 7 | 752159 | 752338 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 8 | 1647166 | 1647345 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 9 | 768359 | 768547 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 10 | 806868 | 807050 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 11 | 787795 | 787977 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 12 | 789214 | 789396 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 13 | 540002 | 540184 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 14 | 318117 | 318296 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 15 | 3248592 | 3248771 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 16 | 1127728 | 1127907 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 17 | 2535783 | 2535959 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 18 | 1191577 | 1191759 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 19 | 1704635 | 1704817 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 20 | 1043854 | 1044036 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 21 | 153521 | 153703 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 22 | 1379887 | 1380069 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 23 | 1009182 | 1009361 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 24 | 1619826 | 1620005 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 25 | 1269641 | 1269823 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 26 | 2029229 | 2029411 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 27 | 1208599 | 1208778 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 28 | 1117535 | 1117717 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 29 | 750013 | 750195 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 30 | 824255 | 824437 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 31 | 1343599 | 1343772 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 32 | 1858766 | 1858954 | + | NC_023035.1 | Salinispira pacifica |
| 33 | 861213 | 861389 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 34 | 1406103 | 1406282 | + | NZ_CP014163.1 | Aerococcus urinaehominis |
| 35 | 4106415 | 4106603 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 36 | 10899374 | 10899562 | + | NZ_CP012333.1 | Labilithrix luteola |
| 37 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 38 | 1941753 | 1941935 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 39 | 1497414 | 1497596 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 40 | 1269370 | 1269543 | + | NZ_CP012024.1 | Bacillus smithii |
| 41 | 1829739 | 1829921 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 42 | 189735 | 189926 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 43 | 1219651 | 1219836 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 44 | 1786985 | 1787185 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 45 | 47802 | 47978 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 46 | 137691 | 137873 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 47 | 1513040 | 1513213 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 48 | 1204701 | 1204889 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 49 | 672019 | 672201 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 50 | 1586935 | 1587129 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 51 | 1598936 | 1599109 | + | NZ_CP027770.1 | Staphylococcus felis |
| 52 | 2856026 | 2856217 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 53 | 1170976 | 1171155 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 54 | 1323746 | 1323928 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 55 | 2085910 | 2086083 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 56 | 878822 | 878995 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 57 | 1257525 | 1257704 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 58 | 2605547 | 2605738 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 59 | 725284 | 725457 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 60 | 1788692 | 1788865 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 61 | 1494765 | 1494938 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 62 | 1999192 | 1999383 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 63 | 151834 | 152025 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 64 | 147710 | 147901 | - | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 65 | 197494 | 197685 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 66 | 851166 | 851348 | + | NZ_CP018799.1 | Mariprofundus aestuarium |
| 67 | 1362718 | 1362906 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 68 | 1856055 | 1856228 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 69 | 1449538 | 1449714 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 70 | 1473534 | 1473707 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 71 | 1889422 | 1889595 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 72 | 1389351 | 1389536 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 73 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 74 | 3362575 | 3362748 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 75 | 2709716 | 2709889 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 76 | 743797 | 743970 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 77 | 1184474 | 1184647 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 78 | 3997549 | 3997722 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 79 | 2508014 | 2508187 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 80 | 1325807 | 1325986 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 81 | 1178578 | 1178751 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 82 | 1378473 | 1378655 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 83 | 1557793 | 1557969 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 84 | 2065775 | 2065960 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 85 | 2092662 | 2092847 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 86 | 1239944 | 1240135 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 87 | 1462250 | 1462426 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 88 | 78824 | 79015 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 89 | 1599842 | 1600015 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 90 | 36718 | 36900 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 91 | 2145973 | 2146155 | - | NZ_CP009687.1 | Clostridium aceticum |
| 92 | 2777768 | 2777947 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 93 | 42176 | 42349 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 94 | 1140408 | 1140590 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 95 | 2177879 | 2178052 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 96 | 2183816 | 2183989 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 97 | 797570 | 797746 | + | NZ_LT906470.1 | Veillonella rodentium |
| 98 | 1252230 | 1252406 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 99 | 1305974 | 1306150 | - | NZ_LR134375.1 | Veillonella dispar |
| 100 | 1364049 | 1364225 | - | NZ_LR778174.1 | Veillonella parvula |
| 101 | 551462 | 551638 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 102 | 1644357 | 1644530 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 103 | 762505 | 762687 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 104 | 1594787 | 1594975 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 105 | 570419 | 570598 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 106 | 406708 | 406887 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 107 | 2754307 | 2754480 | - | NZ_LS483476.1 | Lederbergia lentus |
| 108 | 1027570 | 1027749 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 109 | 621077 | 621259 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 110 | 1900192 | 1900371 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 111 | 1418001 | 1418177 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 112 | 1038074 | 1038253 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 113 | 1079139 | 1079312 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 114 | 2501011 | 2501193 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 115 | 243753 | 243926 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 116 | 3302786 | 3302959 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 117 | 1901972 | 1902148 | + | NZ_CP036259.1 | Sporomusa termitida |
| 118 | 2476313 | 2476498 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 119 | 538130 | 538309 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 120 | 608992 | 609177 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 121 | 1108868 | 1109050 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 122 | 1709030 | 1709215 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 123 | 1031502 | 1031684 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 124 | 1139896 | 1140078 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 125 | 2242608 | 2242781 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 126 | 1567394 | 1567567 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 127 | 1498932 | 1499114 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 128 | 2707246 | 2707419 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 129 | 1221850 | 1222038 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 130 | 2474162 | 2474335 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 131 | 1421752 | 1421934 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 132 | 1498647 | 1498829 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 133 | 239050 | 239232 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 134 | 1372908 | 1373087 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 135 | 2505426 | 2505605 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 136 | 374293 | 374442 | - | NC_012115.1 | Nautilia profundicola AmH |
| 137 | 4156630 | 4156833 | - | NC_018020.1 | Turneriella parva DSM 21527 |
| 138 | 1153792 | 1153971 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 139 | 384396 | 384545 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 140 | 621022 | 621201 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000918.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.88 | 123 | 33 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
++ More..