Result : EXP02371
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02371 |
| NCBI Accession ID | |
| Organism | Blautia,Ruminococcus,Tyzzerella,Fusicatenibacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGATATTATGAATATTGGAATGCTTATTATTATGGTAATCGGAGGGCTTGCAGGGATTCTTTCTACTTTGTATTTGGTTGTCAGTCTTCCTGTGGTTATTATTCAGAAATTTTATCGTAAGATTCGGTTTGGAACGCCTTTAATGAAGTAG |
| Sequence | MDIMNIGMLIIMVIGGLAGILSTLYLVVSLPVVIIQKFYRKIRFGTPLMK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1473885 | 1474028 | + | NZ_CP070062.1 | Coprococcus comes |
| 2 | 1757779 | 1757901 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 3 | 1305536 | 1305679 | + | NZ_LR699011.1 | Roseburia hominis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027002.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13493.8 | 0.67 | 2 | 700.5 | same-strand | Domain of unknown function (DUF4118) |
| 2 | PF02518.28 | 1.0 | 3 | 857 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 3 | PF00072.26 | 1.0 | 3 | 1845.0 | same-strand | Response regulator receiver domain |
| 4 | PF00512.27 | 0.67 | 2 | 2198.0 | same-strand | His Kinase A (phospho-acceptor) domain |
++ More..