Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02365 |
NCBI Accession ID | CU458896.1 |
Organism | Mycobacterium abscessus ATCC 19977 |
Left | 3852765 |
Right | 3852869 |
Strand | - |
Nucleotide Sequence | ATGCTCACGGCCGGTCGGCAAGTGCTTCCAGATGGATCTGATCGCACTGCTGATGCACGACCCCTGACCGAACCCGGTCAGATACGGAAGATCACTTCGCAGTAG |
Sequence | MLTAGRQVLPDGSDRTADARPLTEPGQIRKITSQ |
Source of smORF | Ribo-seq |
Function | The genomic region encoding this ORF has been found to be essential for the bacterium in a transposon mutagenesis screen by Rifat et al. Pubmed:34126767,27495169 |
Pubmed ID | 34126767 27495169 |
Domain | |
Functional Category | Manually curated function from literature |
Uniprot ID | |
ORF Length (Amino Acid) | 34 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3860077 | 3860181 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
2 | 3900294 | 3900392 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
3 | 3914557 | 3914655 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
4 | 3620214 | 3620312 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
5 | 3556367 | 3556465 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
6 | 4457711 | 4457830 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
7 | 5853105 | 5853203 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00327.22 | 1.0 | 7 | 2141 | same-strand | Ribosomal protein L30p/L7e |
2 | PF03719.17 | 1.0 | 7 | 1486 | same-strand | Ribosomal protein S5, C-terminal domain |
3 | PF00333.22 | 1.0 | 7 | 1486 | same-strand | Ribosomal protein S5, N-terminal domain |
4 | PF00861.24 | 1.0 | 7 | 1047 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
5 | PF00347.25 | 1.0 | 7 | 505 | same-strand | Ribosomal protein L6 |
6 | PF00410.21 | 1.0 | 7 | 79 | same-strand | Ribosomal protein S8 |
7 | PF00208.23 | 0.71 | 5 | 625 | same-strand | Glutamate/Leucine/Phenylalanine/Valine dehydrogenase |
8 | PF02812.20 | 0.71 | 5 | 625 | same-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
9 | PF00135.30 | 0.71 | 5 | 5037 | same-strand | Carboxylesterase family |