Result : EXP02365
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02365 |
| NCBI Accession ID | CU458896.1 |
| Organism | Mycobacterium abscessus ATCC 19977 |
| Left | 3852765 |
| Right | 3852869 |
| Strand | - |
| Nucleotide Sequence | ATGCTCACGGCCGGTCGGCAAGTGCTTCCAGATGGATCTGATCGCACTGCTGATGCACGACCCCTGACCGAACCCGGTCAGATACGGAAGATCACTTCGCAGTAG |
| Sequence | MLTAGRQVLPDGSDRTADARPLTEPGQIRKITSQ |
| Source of smORF | Ribo-seq |
| Function | The genomic region encoding this ORF has been found to be essential for the bacterium in a transposon mutagenesis screen by Rifat et al. Pubmed:34126767,27495169 |
| Pubmed ID | 34126767 27495169 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3860077 | 3860181 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 2 | 3900294 | 3900392 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 3 | 3914557 | 3914655 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 4 | 3620214 | 3620312 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 5 | 3556367 | 3556465 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 6 | 4457711 | 4457830 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 7 | 5853105 | 5853203 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014955.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00327.22 | 1.0 | 7 | 2141 | same-strand | Ribosomal protein L30p/L7e |
| 2 | PF03719.17 | 1.0 | 7 | 1486 | same-strand | Ribosomal protein S5, C-terminal domain |
| 3 | PF00333.22 | 1.0 | 7 | 1486 | same-strand | Ribosomal protein S5, N-terminal domain |
| 4 | PF00861.24 | 1.0 | 7 | 1047 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 5 | PF00347.25 | 1.0 | 7 | 505 | same-strand | Ribosomal protein L6 |
| 6 | PF00410.21 | 1.0 | 7 | 79 | same-strand | Ribosomal protein S8 |
| 7 | PF00208.23 | 0.71 | 5 | 625 | same-strand | Glutamate/Leucine/Phenylalanine/Valine dehydrogenase |
| 8 | PF02812.20 | 0.71 | 5 | 625 | same-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
| 9 | PF00135.30 | 0.71 | 5 | 5037 | same-strand | Carboxylesterase family |
++ More..