Result : EXP02364
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02364 |
| NCBI Accession ID | CU458896.1 |
| Organism | Mycobacterium abscessus ATCC 19977 |
| Left | 3513640 |
| Right | 3513777 |
| Strand | - |
| Nucleotide Sequence | GTGACGGGGCTGAACGGTTTCGACAGCGAGTCTCGACTTAAGGGAAGCGTGCCGGTGCAGGCAAGAGACCACCGTAAGCGTCATTGCAACCAATTAAGCGCCGATTCTCATCAGCGCGACTACGCACTCGCTGCCTAA |
| Sequence | VTGLNGFDSESRLKGSVPVQARDHRKRHCNQLSADSHQRDYALAA |
| Source of smORF | Ribo-seq |
| Function | The genomic region encoding this ORF has been found to be essential for the bacterium in a transposon mutagenesis screen by Rifat et al. Pubmed:34126767,27495169 |
| Pubmed ID | 34126767 27495169 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3912009 | 3912146 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 2 | 3520954 | 3521091 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 3 | 3314951 | 3315088 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 4 | 3580124 | 3580261 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 5 | 3538130 | 3538267 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 6 | 3248247 | 3248384 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 7 | 1763663 | 1763803 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 8 | 3162137 | 3162271 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 9 | 648950 | 649084 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 10 | 8315049 | 8315195 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 11 | 1824680 | 1824820 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 12 | 1807312 | 1807452 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 13 | 5645983 | 5646123 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 14 | 4956517 | 4956651 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 15 | 1691485 | 1691628 | + | NZ_AP023396.1 | Nocardia wallacei |
| 16 | 2241953 | 2242105 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 17 | 5399635 | 5399787 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 18 | 3440719 | 3440859 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 19 | 2047369 | 2047509 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 20 | 692362 | 692496 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 21 | 1175541 | 1175690 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 22 | 719848 | 719958 | + | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 23 | 1054931 | 1055044 | + | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 24 | 1018366 | 1018479 | + | NZ_CP023445.1 | Actinosynnema pretiosum |
| 25 | 3176846 | 3176956 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 26 | 1527166 | 1527309 | + | NZ_CP009312.1 | Lawsonella clevelandensis |
| 27 | 5731913 | 5732023 | + | NZ_CP033972.1 | Gordonia insulae |
| 28 | 4709967 | 4710098 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 29 | 1884610 | 1884753 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 30 | 4193224 | 4193361 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01668.20 | 0.83 | 25 | 1818 | same-strand | SmpB protein |
| 2 | PF18075.3 | 0.63 | 19 | 2312 | same-strand | FtsX extracellular domain |
| 3 | PF02687.23 | 0.63 | 19 | 2312 | same-strand | FtsX-like permease family |
| 4 | PF00005.29 | 0.63 | 19 | 3206 | same-strand | ABC transporter |
++ More..