Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02361 |
NCBI Accession ID | CU458896.1 |
Organism | Mycobacterium abscessus ATCC 19977 |
Left | 2088740 |
Right | 2088859 |
Strand | - |
Nucleotide Sequence | GTGCCGTGTCTAATATGCCTCCCGACCCCGATGCATCTGACTCACGCGAGGACGGTGCACCTACCAAAGAGGCCTGTGCCAAGCTCTATCAGGAAGTGGGTCTGCTGCACGATCAGGTGA |
Sequence | VPCLICLPTPMHLTHARTVHLPKRPVPSSIRKWVCCTIR |
Source of smORF | Ribo-seq |
Function | The genomic region encoding this ORF has been found to confer the bacterium with a growth advantage when mutated in a transposon mutagenesis screen by Rifat et al. Pubmed:34126767,27495169 |
Pubmed ID | 34126767 27495169 |
Domain | |
Functional Category | Manually curated function from literature |
Uniprot ID | |
ORF Length (Amino Acid) | 39 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1161393 | 1161512 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
2 | 2219490 | 2219609 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
3 | 2225165 | 2225284 | - | NZ_CP023147.1 | Mycobacterium marseillense |
4 | 2095980 | 2096099 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08240.14 | 0.75 | 3 | 3085 | opposite-strand | Alcohol dehydrogenase GroES-like domain |
2 | PF00107.28 | 0.75 | 3 | 3085 | opposite-strand | Zinc-binding dehydrogenase |
3 | PF13602.8 | 0.75 | 3 | 3085 | opposite-strand | Zinc-binding dehydrogenase |
4 | PF00441.26 | 1.0 | 4 | 1725.0 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
5 | PF02770.21 | 1.0 | 4 | 1725.0 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
6 | PF02771.18 | 1.0 | 4 | 1725.0 | opposite-strand | Acyl-CoA dehydrogenase, N-terminal domain |
7 | PF08028.13 | 1.0 | 4 | 1725.0 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
8 | PF13683.8 | 1.0 | 4 | 627.0 | both-strands | Integrase core domain |
9 | PF13333.8 | 1.0 | 4 | 627.0 | both-strands | Integrase core domain |
10 | PF01527.22 | 1.0 | 4 | 864.0 | opposite-strand | Transposase |
11 | PF00665.28 | 1.0 | 4 | 10.0 | opposite-strand | Integrase core domain |
12 | PF01734.24 | 1.0 | 4 | 2315.0 | opposite-strand | Patatin-like phospholipase |
13 | PF18144.3 | 1.0 | 4 | 3417.0 | opposite-strand | Second Messenger Oligonucleotide or Dinucleotide Synthetase domain |