Result : EXP02361
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02361 |
| NCBI Accession ID | CU458896.1 |
| Organism | Mycobacterium abscessus ATCC 19977 |
| Left | 2088740 |
| Right | 2088859 |
| Strand | - |
| Nucleotide Sequence | GTGCCGTGTCTAATATGCCTCCCGACCCCGATGCATCTGACTCACGCGAGGACGGTGCACCTACCAAAGAGGCCTGTGCCAAGCTCTATCAGGAAGTGGGTCTGCTGCACGATCAGGTGA |
| Sequence | VPCLICLPTPMHLTHARTVHLPKRPVPSSIRKWVCCTIR |
| Source of smORF | Ribo-seq |
| Function | The genomic region encoding this ORF has been found to confer the bacterium with a growth advantage when mutated in a transposon mutagenesis screen by Rifat et al. Pubmed:34126767,27495169 |
| Pubmed ID | 34126767 27495169 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1161393 | 1161512 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 2 | 2219490 | 2219609 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 3 | 2225165 | 2225284 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 4 | 2095980 | 2096099 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022586.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08240.14 | 0.75 | 3 | 3085 | opposite-strand | Alcohol dehydrogenase GroES-like domain |
| 2 | PF00107.28 | 0.75 | 3 | 3085 | opposite-strand | Zinc-binding dehydrogenase |
| 3 | PF13602.8 | 0.75 | 3 | 3085 | opposite-strand | Zinc-binding dehydrogenase |
| 4 | PF00441.26 | 1.0 | 4 | 1725.0 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 5 | PF02770.21 | 1.0 | 4 | 1725.0 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
| 6 | PF02771.18 | 1.0 | 4 | 1725.0 | opposite-strand | Acyl-CoA dehydrogenase, N-terminal domain |
| 7 | PF08028.13 | 1.0 | 4 | 1725.0 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 8 | PF13683.8 | 1.0 | 4 | 627.0 | both-strands | Integrase core domain |
| 9 | PF13333.8 | 1.0 | 4 | 627.0 | both-strands | Integrase core domain |
| 10 | PF01527.22 | 1.0 | 4 | 864.0 | opposite-strand | Transposase |
| 11 | PF00665.28 | 1.0 | 4 | 10.0 | opposite-strand | Integrase core domain |
| 12 | PF01734.24 | 1.0 | 4 | 2315.0 | opposite-strand | Patatin-like phospholipase |
| 13 | PF18144.3 | 1.0 | 4 | 3417.0 | opposite-strand | Second Messenger Oligonucleotide or Dinucleotide Synthetase domain |
++ More..