Result : EXP02353
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02353 |
| NCBI Accession ID | CU458896.1 |
| Organism | Mycobacterium abscessus ATCC 19977 |
| Left | 186938 |
| Right | 187228 |
| Strand | + |
| Nucleotide Sequence | ATGACAAACGTTCAGCCCTTGACCTGTCCGAAGTGTGAATCACAGATGCTGTCGACGAAATGGTTCGGCGTACGCACATTTCAATGCACGGGATGTGCGGCGCTGTTACTGGAGCAGGACAGCCTGCAGCAGTTCGTGGATGGAGCCGCGCGTTTCGGCCCGTCGGCGCATATCGACCAGCCGCCCACGGCGCAGCCGTACCCACCCGCGCCTCCTCAGGACTACCGGGGATTTATGGGCGGACTCTTCGGCGGAGGCGGCCACGGATATCGCCGCCGGGGCCACCACTGA |
| Sequence | MTNVQPLTCPKCESQMLSTKWFGVRTFQCTGCAALLLEQDSLQQFVDGAARFGPSAHIDQPPTAQPYPPAPPQDYRGFMGGLFGGGGHGYRRRGHH |
| Source of smORF | Ribo-seq |
| Function | The genomic region encoding this ORF has been found to confer the bacterium with a growth advantage when mutated in a transposon mutagenesis screen by Rifat et al. Pubmed:34126767,27495169 |
| Pubmed ID | 34126767 27495169 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 186788 | 187078 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 2 | 234705 | 234995 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 3 | 172071 | 172373 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014955.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00501.30 | 1.0 | 3 | 8508 | same-strand | AMP-binding enzyme |
| 2 | PF00109.28 | 1.0 | 3 | 3109 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 3 | PF00698.23 | 1.0 | 3 | 3109 | same-strand | Acyl transferase domain |
| 4 | PF02801.24 | 1.0 | 3 | 3109 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 5 | PF00550.27 | 1.0 | 3 | 3109 | same-strand | Phosphopantetheine attachment site |
| 6 | PF01039.24 | 1.0 | 3 | 1540 | same-strand | Carboxyl transferase domain |
| 7 | PF01545.23 | 1.0 | 3 | 51 | opposite-strand | Cation efflux family |
| 8 | PF04602.14 | 1.0 | 3 | 3247.5 | opposite-strand | Mycobacterial cell wall arabinan synthesis protein |
| 9 | PF14896.8 | 1.0 | 3 | 3247.5 | opposite-strand | EmbC C-terminal domain |
| 10 | PF17689.3 | 1.0 | 3 | 3247.5 | opposite-strand | Arabinosyltransferase concanavalin like domain |
| 11 | PF13191.8 | 1.0 | 3 | 6768 | same-strand | AAA ATPase domain |
++ More..