Result : EXP02351
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02351 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 1210769 |
| Right | 1211005 |
| Strand | - |
| Nucleotide Sequence | ATGACGAATAATGCAACCCACGTATCATTAGTATTACCAATTATTTTAAGTGCAGGAATTACAAAGATGATGGATAAAACACTCCAAATAAGCAATGAGGCTTTTGTACCAATTTTATCTGCTAAAGAACCAAATATAGGTTGGAGTAACATGAAAATGAAGAGTGCAGCTGTCATTATCGTTGTAGCAGTATGTTTCTCAAATCCGGTAGTTGTGATCAGATACTTTTGCATGTAA |
| Sequence | MTNNATHVSLVLPIILSAGITKMMDKTLQISNEAFVPILSAKEPNIGWSNMKMKSAAVIIVVAVCFSNPVVVIRYFCM |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Inner Membrane exclusive. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1196099 | 1196335 | - | NZ_HG965802.1 | Bartonella henselae |
| 2 | 1200248 | 1200442 | - | NZ_HG965802.1 | Bartonella henselae |
| 3 | 303006 | 303242 | - | NZ_CP058235.1 | Bartonella alsatica |
| 4 | 1145794 | 1146000 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 5 | 1149808 | 1150005 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 6 | 1769275 | 1769481 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 7 | 1773179 | 1773376 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 8 | 1261255 | 1261488 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 9 | 1263826 | 1264065 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 10 | 1267167 | 1267403 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 11 | 1539284 | 1539520 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 12 | 1669711 | 1669908 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 13 | 1674324 | 1674530 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 14 | 1032164 | 1032355 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 15 | 1028107 | 1028304 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 16 | 1361151 | 1361387 | - | NZ_LR134529.1 | Bartonella vinsonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012846.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01145.27 | 1.0 | 9 | 3570 | same-strand | SPFH domain / Band 7 family |
| 2 | PF00186.21 | 1.0 | 9 | 2731.5 | same-strand | Dihydrofolate reductase |
| 3 | PF00303.21 | 1.0 | 9 | 2873 | same-strand | Thymidylate synthase |
| 4 | PF07690.18 | 1.0 | 9 | 1195 | opposite-strand | Major Facilitator Superfamily |
| 5 | PF11015.10 | 0.89 | 8 | 3030.0 | same-strand | Protein of unknown function (DUF2853) |
| 6 | PF04386.15 | 1.0 | 9 | 3964.0 | opposite-strand | Stringent starvation protein B |
| 7 | PF13770.8 | 0.89 | 8 | 3829 | opposite-strand | Domain of unknown function (DUF4169) |
| 8 | PF13467.8 | 0.89 | 8 | 2077.5 | opposite-strand | Ribbon-helix-helix domain |
++ More..