Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02349 |
NCBI Accession ID | NC_005956.1 |
Organism | Bartonella henselae str. Houston-1 |
Left | 31933 |
Right | 32067 |
Strand | - |
Nucleotide Sequence | ATGTCCTCGATGTACTCCTCAATATCGGGCGTGAAGAATTTAATAAATTCAATTTGCCACTCGATATTGAAGCAATCTGGTGGAACAATTTTGAAAATCTTGCTCCATTTTTTCTCCAATGGGAACAAAGTTTAG |
Sequence | MSSMYSSISGVKNLINSICHSILKQSGGTILKILLHFFSNGNKV |
Source of smORF | Protein-level |
Function | The localisation of the protein was found to be: Cytoplasmic predominant. Pubmed:29141959 |
Pubmed ID | 29141959 |
Domain | |
Functional Category | Manually curated function from literature |
Uniprot ID | |
ORF Length (Amino Acid) | 44 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 31933 | 32067 | - | NZ_HG965802.1 | Bartonella henselae |
2 | 320728 | 320862 | + | NZ_CP031843.2 | Bartonella kosoyi |
3 | 1901016 | 1901150 | + | NZ_LR134527.1 | Bartonella elizabethae |
4 | 262375 | 262509 | - | NZ_LR134529.1 | Bartonella vinsonii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01921.20 | 1.0 | 4 | 5292.0 | both-strands | tRNA synthetases class I (K) |
2 | PF00009.29 | 1.0 | 4 | 3716.5 | both-strands | Elongation factor Tu GTP binding domain |
3 | PF16658.7 | 1.0 | 4 | 3716.5 | both-strands | Class II release factor RF3, C-terminal domain |
4 | PF03144.27 | 1.0 | 4 | 3716.5 | both-strands | Elongation factor Tu domain 2 |
5 | PF01926.25 | 1.0 | 4 | 3716.5 | both-strands | 50S ribosome-binding GTPase |
6 | PF00085.22 | 1.0 | 4 | 4131.5 | same-strand | Thioredoxin |
7 | PF13098.8 | 1.0 | 4 | 4131.5 | same-strand | Thioredoxin-like domain |
8 | PF05768.16 | 0.75 | 3 | 4167 | same-strand | Glutaredoxin-like domain (DUF836) |
9 | PF13192.8 | 1.0 | 4 | 4131.5 | same-strand | Thioredoxin domain |
10 | PF00580.23 | 1.0 | 4 | 516.5 | same-strand | UvrD/REP helicase N-terminal domain |
11 | PF13361.8 | 1.0 | 4 | 516.5 | same-strand | UvrD-like helicase C-terminal domain |
12 | PF13245.8 | 1.0 | 4 | 516.5 | same-strand | AAA domain |
13 | PF02367.19 | 1.0 | 4 | 4951.0 | both-strands | Threonylcarbamoyl adenosine biosynthesis protein TsaE |
14 | PF12860.9 | 1.0 | 4 | 5430.0 | both-strands | PAS fold |
15 | PF02518.28 | 1.0 | 4 | 5430.0 | both-strands | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
16 | PF00512.27 | 1.0 | 4 | 5430.0 | both-strands | His Kinase A (phospho-acceptor) domain |
17 | PF14501.8 | 1.0 | 4 | 5430.0 | both-strands | GHKL domain |
18 | PF05221.19 | 0.75 | 3 | 7634 | opposite-strand | S-adenosyl-L-homocysteine hydrolase |
19 | PF00670.23 | 0.75 | 3 | 7634 | opposite-strand | S-adenosyl-L-homocysteine hydrolase, NAD binding domain |