Result : EXP02349
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02349 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 31933 |
| Right | 32067 |
| Strand | - |
| Nucleotide Sequence | ATGTCCTCGATGTACTCCTCAATATCGGGCGTGAAGAATTTAATAAATTCAATTTGCCACTCGATATTGAAGCAATCTGGTGGAACAATTTTGAAAATCTTGCTCCATTTTTTCTCCAATGGGAACAAAGTTTAG |
| Sequence | MSSMYSSISGVKNLINSICHSILKQSGGTILKILLHFFSNGNKV |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Cytoplasmic predominant. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 31933 | 32067 | - | NZ_HG965802.1 | Bartonella henselae |
| 2 | 320728 | 320862 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 3 | 1901016 | 1901150 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 4 | 262375 | 262509 | - | NZ_LR134529.1 | Bartonella vinsonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031843.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01921.20 | 1.0 | 4 | 5292.0 | both-strands | tRNA synthetases class I (K) |
| 2 | PF00009.29 | 1.0 | 4 | 3716.5 | both-strands | Elongation factor Tu GTP binding domain |
| 3 | PF16658.7 | 1.0 | 4 | 3716.5 | both-strands | Class II release factor RF3, C-terminal domain |
| 4 | PF03144.27 | 1.0 | 4 | 3716.5 | both-strands | Elongation factor Tu domain 2 |
| 5 | PF01926.25 | 1.0 | 4 | 3716.5 | both-strands | 50S ribosome-binding GTPase |
| 6 | PF00085.22 | 1.0 | 4 | 4131.5 | same-strand | Thioredoxin |
| 7 | PF13098.8 | 1.0 | 4 | 4131.5 | same-strand | Thioredoxin-like domain |
| 8 | PF05768.16 | 0.75 | 3 | 4167 | same-strand | Glutaredoxin-like domain (DUF836) |
| 9 | PF13192.8 | 1.0 | 4 | 4131.5 | same-strand | Thioredoxin domain |
| 10 | PF00580.23 | 1.0 | 4 | 516.5 | same-strand | UvrD/REP helicase N-terminal domain |
| 11 | PF13361.8 | 1.0 | 4 | 516.5 | same-strand | UvrD-like helicase C-terminal domain |
| 12 | PF13245.8 | 1.0 | 4 | 516.5 | same-strand | AAA domain |
| 13 | PF02367.19 | 1.0 | 4 | 4951.0 | both-strands | Threonylcarbamoyl adenosine biosynthesis protein TsaE |
| 14 | PF12860.9 | 1.0 | 4 | 5430.0 | both-strands | PAS fold |
| 15 | PF02518.28 | 1.0 | 4 | 5430.0 | both-strands | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 16 | PF00512.27 | 1.0 | 4 | 5430.0 | both-strands | His Kinase A (phospho-acceptor) domain |
| 17 | PF14501.8 | 1.0 | 4 | 5430.0 | both-strands | GHKL domain |
| 18 | PF05221.19 | 0.75 | 3 | 7634 | opposite-strand | S-adenosyl-L-homocysteine hydrolase |
| 19 | PF00670.23 | 0.75 | 3 | 7634 | opposite-strand | S-adenosyl-L-homocysteine hydrolase, NAD binding domain |
++ More..