Result : EXP02348
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02348 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 1630671 |
| Right | 1630823 |
| Strand | - |
| Nucleotide Sequence | ATGTTTGTTCCGTTTTTAATCGCTTTAGGTACAGCAATAACGACTGTGTATGGCAAAAAAAACATAAGTTATGCCTTATGGGCAATCCTGTTAGTTGTTATTCTTCTCACTTTTAATCATCATGCAACTTCTACTTTAAATCTGTCTTTTTGA |
| Sequence | MFVPFLIALGTAITTVYGKKNISYALWAILLVVILLTFNHHATSTLNLSF |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Inner Membrane exclusive. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1608452 | 1608604 | - | NZ_HG965802.1 | Bartonella henselae |
| 2 | 1338764 | 1338916 | - | NZ_AP019773.1 | Bartonella quintana |
| 3 | 1340026 | 1340172 | - | NZ_AP019773.1 | Bartonella quintana |
| 4 | 2130253 | 2130405 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 5 | 1988850 | 1989002 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 6 | 1715 | 1867 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 7 | 1519176 | 1519328 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 8 | 1647784 | 1647936 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 9 | 698089 | 698241 | - | NZ_CP058235.1 | Bartonella alsatica |
| 10 | 1777603 | 1777755 | - | NZ_LR134529.1 | Bartonella vinsonii |
| 11 | 2141526 | 2141678 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 12 | 1107874 | 1108026 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 13 | 196471 | 196623 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 14 | 254485 | 254637 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 15 | 1045147 | 1045299 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 16 | 4119922 | 4120074 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 17 | 3783740 | 3783892 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
++ More..