Result : EXP02347
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02347 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 1266107 |
| Right | 1266289 |
| Strand | - |
| Nucleotide Sequence | ATGAAGAATGAAGAAAACTTTGAGAAAGTTTTACCGCGTATTATTGTGAAATGGGAGGCTTTGTCTAAAACTCAAAAGCAAGAGATATTGGAAAGAGTAGAAAATGTTACTGCTTCTTCTCAGTCAACAGAAGACTTAAAGCTTCAATCTTCTTTTTATCTCCAGACGAAATCAAAGCTATGA |
| Sequence | MKNEENFEKVLPRIIVKWEALSKTQKQEILERVENVTASSQSTEDLKLQSSFYLQTKSKL |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Cytoplasmic predominant. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1251437 | 1251619 | - | NZ_HG965802.1 | Bartonella henselae |
| 2 | 462518 | 462700 | + | NZ_AP019773.1 | Bartonella quintana |
| 3 | 1197682 | 1197864 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 4 | 1820952 | 1821134 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 5 | 1591307 | 1591489 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 6 | 1723997 | 1724179 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 7 | 1316362 | 1316544 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 8 | 1409937 | 1410119 | - | NZ_LR134529.1 | Bartonella vinsonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012846.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07411.14 | 1.0 | 8 | 2623.0 | opposite-strand | Domain of unknown function (DUF1508) |
| 2 | PF01381.24 | 1.0 | 8 | -76 | opposite-strand | Helix-turn-helix |
| 3 | PF04402.16 | 1.0 | 8 | 1615.5 | opposite-strand | Protein of unknown function (DUF541) |
| 4 | PF03692.17 | 0.88 | 7 | 2302 | same-strand | Putative zinc- or iron-chelating domain |
| 5 | PF04546.15 | 0.88 | 7 | 3377 | same-strand | Sigma-70, non-essential region |
| 6 | PF04539.18 | 0.88 | 7 | 3377 | same-strand | Sigma-70 region 3 |
| 7 | PF04542.16 | 0.88 | 7 | 3377 | same-strand | Sigma-70 region 2 |
| 8 | PF04545.18 | 0.88 | 7 | 3377 | same-strand | Sigma-70, region 4 |
| 9 | PF00140.22 | 0.88 | 7 | 3377 | same-strand | Sigma-70 factor, region 1.2 |
| 10 | PF08275.13 | 0.88 | 7 | 5780 | same-strand | DNA primase catalytic core, N-terminal domain |
| 11 | PF01807.22 | 0.88 | 7 | 5780 | same-strand | CHC2 zinc finger |
| 12 | PF13662.8 | 0.88 | 7 | 5780 | same-strand | Toprim domain |
| 13 | PF13155.8 | 0.88 | 7 | 5780 | same-strand | Toprim-like |
| 14 | PF13362.8 | 0.62 | 5 | 6170 | same-strand | Toprim domain |
| 15 | PF01751.24 | 0.88 | 7 | 5780 | same-strand | Toprim domain |
| 16 | PF00924.20 | 0.75 | 6 | 7764.5 | opposite-strand | Mechanosensitive ion channel |
| 17 | PF03979.16 | 0.75 | 6 | 3281.0 | same-strand | Sigma-70 factor, region 1.1 |
++ More..