Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02345 |
NCBI Accession ID | NC_005956.1 |
Organism | Bartonella henselae str. Houston-1 |
Left | 453085 |
Right | 453228 |
Strand | - |
Nucleotide Sequence | ATGTCTGCTAAAAAAGCCACGGTTATTACTATTATAACCCTCTTCGCCTTTATTCTCATTACTGTAGGAATTGGCTCTGTTGGAGCAGATGGGAAGCGCACAATAACCGAAGATGGTTATGGCATCTCATCTCAAATTCAATAA |
Sequence | MSAKKATVITIITLFAFILITVGIGSVGADGKRTITEDGYGISSQIQ |
Source of smORF | Protein-level |
Function | The localisation of the protein was found to be: Inner Membrane exclusive. Pubmed:29141959 |
Pubmed ID | 29141959 |
Domain | |
Functional Category | Manually curated function from literature |
Uniprot ID | |
ORF Length (Amino Acid) | 47 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 451857 | 452000 | - | NZ_HG965802.1 | Bartonella henselae |
2 | 372222 | 372365 | - | NZ_AP019773.1 | Bartonella quintana |
3 | 633587 | 633730 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
4 | 282804 | 282947 | - | NZ_CP031844.2 | Bartonella krasnovii |
5 | 323806 | 323949 | - | NZ_LR134527.1 | Bartonella elizabethae |
6 | 1065130 | 1065273 | - | NZ_CP031843.2 | Bartonella kosoyi |
7 | 658886 | 659029 | - | NZ_LR134529.1 | Bartonella vinsonii |
8 | 516170 | 516313 | - | NC_012846.1 | Bartonella grahamii as4aup |
9 | 256820 | 256963 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
10 | 1326918 | 1327061 | - | NZ_CP058235.1 | Bartonella alsatica |
11 | 265207 | 265365 | - | NC_014932.1 | Bartonella clarridgeiae 73 |
12 | 288488 | 288631 | - | NC_008783.1 | Bartonella bacilliformis KC583 |
13 | 16039 | 16182 | + | NZ_CP010401.1 | Bartonella ancashensis |
14 | 25052 | 25189 | + | NZ_LT605586.1 | Brucella inopinata |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02882.21 | 0.86 | 12 | 2302.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
2 | PF00763.25 | 0.86 | 12 | 2302.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
3 | PF04452.16 | 0.93 | 13 | 226 | opposite-strand | RNA methyltransferase |
4 | PF04107.15 | 0.93 | 13 | 1045 | opposite-strand | Glutamate-cysteine ligase family 2(GCS2) |