Result : EXP02345
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02345 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 453085 |
| Right | 453228 |
| Strand | - |
| Nucleotide Sequence | ATGTCTGCTAAAAAAGCCACGGTTATTACTATTATAACCCTCTTCGCCTTTATTCTCATTACTGTAGGAATTGGCTCTGTTGGAGCAGATGGGAAGCGCACAATAACCGAAGATGGTTATGGCATCTCATCTCAAATTCAATAA |
| Sequence | MSAKKATVITIITLFAFILITVGIGSVGADGKRTITEDGYGISSQIQ |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Inner Membrane exclusive. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 451857 | 452000 | - | NZ_HG965802.1 | Bartonella henselae |
| 2 | 372222 | 372365 | - | NZ_AP019773.1 | Bartonella quintana |
| 3 | 633587 | 633730 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 4 | 282804 | 282947 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 5 | 323806 | 323949 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 6 | 1065130 | 1065273 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 7 | 658886 | 659029 | - | NZ_LR134529.1 | Bartonella vinsonii |
| 8 | 516170 | 516313 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 9 | 256820 | 256963 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 10 | 1326918 | 1327061 | - | NZ_CP058235.1 | Bartonella alsatica |
| 11 | 265207 | 265365 | - | NC_014932.1 | Bartonella clarridgeiae 73 |
| 12 | 288488 | 288631 | - | NC_008783.1 | Bartonella bacilliformis KC583 |
| 13 | 16039 | 16182 | + | NZ_CP010401.1 | Bartonella ancashensis |
| 14 | 25052 | 25189 | + | NZ_LT605586.1 | Brucella inopinata |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_HG965802.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02882.21 | 0.86 | 12 | 2302.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 2 | PF00763.25 | 0.86 | 12 | 2302.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 3 | PF04452.16 | 0.93 | 13 | 226 | opposite-strand | RNA methyltransferase |
| 4 | PF04107.15 | 0.93 | 13 | 1045 | opposite-strand | Glutamate-cysteine ligase family 2(GCS2) |
++ More..