Result : EXP02344
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02344 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 248274 |
| Right | 248423 |
| Strand | - |
| Nucleotide Sequence | ATGAACACTTACAATAATGGGAAAACAACTTCATCTAAAGGCCGTCACAATACACTGCCCTCAAACAATGGAAAGAAATCCATCCAAAGTGATCAGGCTAACACTCGCCAACGCGCGTCAAAATCAGAGCGGAAGACGACAAAAAGTTAA |
| Sequence | MNTYNNGKTTSSKGRHNTLPSNNGKKSIQSDQANTRQRASKSERKTTKS |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Cytoplasmic predominant. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 247561 | 247710 | - | NZ_HG965802.1 | Bartonella henselae |
| 2 | 1173276 | 1173425 | - | NZ_CP058235.1 | Bartonella alsatica |
| 3 | 255754 | 255900 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 4 | 223234 | 223380 | - | NZ_AP019773.1 | Bartonella quintana |
| 5 | 568632 | 568778 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 6 | 134255 | 134401 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 7 | 106399 | 106545 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 8 | 279674 | 279820 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 9 | 460908 | 461057 | - | NZ_LR134529.1 | Bartonella vinsonii |
| 10 | 374207 | 374353 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 11 | 1211145 | 1211294 | + | NC_014932.1 | Bartonella clarridgeiae 73 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP058235.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14532.8 | 1.0 | 11 | 3806 | opposite-strand | Sigma-54 interaction domain |
| 2 | PF02954.21 | 1.0 | 11 | 3806 | opposite-strand | Bacterial regulatory protein, Fis family |
| 3 | PF00072.26 | 1.0 | 11 | 3806 | opposite-strand | Response regulator receiver domain |
| 4 | PF13091.8 | 1.0 | 11 | 1837 | opposite-strand | PLD-like domain |
| 5 | PF00614.24 | 1.0 | 11 | 1837 | opposite-strand | Phospholipase D Active site motif |
| 6 | PF00478.27 | 1.0 | 11 | 178 | opposite-strand | IMP dehydrogenase / GMP reductase domain |
| 7 | PF00571.30 | 1.0 | 11 | 183.5 | opposite-strand | CBS domain |
| 8 | PF01189.19 | 1.0 | 11 | 523 | opposite-strand | 16S rRNA methyltransferase RsmB/F |
| 9 | PF00958.24 | 1.0 | 11 | 1940 | opposite-strand | GMP synthase C terminal domain |
| 10 | PF00117.30 | 1.0 | 11 | 1940 | opposite-strand | Glutamine amidotransferase class-I |
| 11 | PF03009.19 | 1.0 | 11 | 3674 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |
| 12 | PF00528.24 | 0.64 | 7 | 5984 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 13 | PF01380.24 | 0.64 | 7 | 6081 | opposite-strand | SIS domain |
++ More..