Result : EXP02342
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02342 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 1392322 |
| Right | 1392423 |
| Strand | + |
| Nucleotide Sequence | ATGCACTGTCACGACAGAGCTCAACAATTTATGCAAACTGGGGTGGCAAATGGGCAGCGTGGGCTGGAGCAACTTACAAACTCACTCCACAAGCAAATTTGA |
| Sequence | MHCHDRAQQFMQTGVANGQRGLEQLTNSLHKQI |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Inner Membrane exclusive. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1377595 | 1377696 | + | NZ_HG965802.1 | Bartonella henselae |
| 2 | 1573743 | 1573853 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 3 | 2026636 | 2026737 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 4 | 1877404 | 1877505 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 5 | 1555083 | 1555184 | + | NZ_CP031844.2 | Bartonella krasnovii |
| 6 | 1281182 | 1281283 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 7 | 1311817 | 1311909 | + | NZ_CP010401.1 | Bartonella ancashensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_HG965802.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07690.18 | 0.86 | 6 | 4191 | same-strand | Major Facilitator Superfamily |
| 2 | PF02530.16 | 1.0 | 7 | -101 | same-strand | Porin subfamily |
| 3 | PF01510.27 | 0.86 | 6 | 1354.0 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
++ More..