Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02342 |
NCBI Accession ID | NC_005956.1 |
Organism | Bartonella henselae str. Houston-1 |
Left | 1392322 |
Right | 1392423 |
Strand | + |
Nucleotide Sequence | ATGCACTGTCACGACAGAGCTCAACAATTTATGCAAACTGGGGTGGCAAATGGGCAGCGTGGGCTGGAGCAACTTACAAACTCACTCCACAAGCAAATTTGA |
Sequence | MHCHDRAQQFMQTGVANGQRGLEQLTNSLHKQI |
Source of smORF | Protein-level |
Function | The localisation of the protein was found to be: Inner Membrane exclusive. Pubmed:29141959 |
Pubmed ID | 29141959 |
Domain | |
Functional Category | Manually curated function from literature |
Uniprot ID | |
ORF Length (Amino Acid) | 33 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1377595 | 1377696 | + | NZ_HG965802.1 | Bartonella henselae |
2 | 1573743 | 1573853 | + | NZ_LR134529.1 | Bartonella vinsonii |
3 | 2026636 | 2026737 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
4 | 1877404 | 1877505 | + | NC_012846.1 | Bartonella grahamii as4aup |
5 | 1555083 | 1555184 | + | NZ_CP031844.2 | Bartonella krasnovii |
6 | 1281182 | 1281283 | + | NZ_LR134527.1 | Bartonella elizabethae |
7 | 1311817 | 1311909 | + | NZ_CP010401.1 | Bartonella ancashensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07690.18 | 0.86 | 6 | 4191 | same-strand | Major Facilitator Superfamily |
2 | PF02530.16 | 1.0 | 7 | -101 | same-strand | Porin subfamily |
3 | PF01510.27 | 0.86 | 6 | 1354.0 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |