ProsmORF-pred
Result : EXP02339
Protein Information
Information Type Description
Protein name EXP02339
NCBI Accession ID NC_005956.1
Organism Bartonella henselae str. Houston-1
Left 318344
Right 318478
Strand +
Nucleotide Sequence ATGTTTGTGATAAGTTTAATGGCTTCCATTGCTTGGAGTGTTCCAATGACTCCGGGTAAAGCGCCGATAATTCCAGTTTCAGCACATGTTGAGAGAGTGCCGGGAGCTGGTGGATTTGGGAATAAATCACGATAG
Sequence MFVISLMASIAWSVPMTPGKAPIIPVSAHVERVPGAGGFGNKSR
Source of smORF Protein-level
Function The localisation of the protein was found to be: Inner Membrane exclusive. Pubmed:29141959
Pubmed ID 29141959
Domain
Functional Category Manually curated function from literature
Uniprot ID
ORF Length (Amino Acid) 44
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 104
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 317643 317777 + NZ_HG965802.1 Bartonella henselae
2 527573 527707 + NZ_LR134529.1 Bartonella vinsonii
3 201452 201580 + NC_014932.1 Bartonella clarridgeiae 73
4 192681 192809 + NC_020300.1 Bartonella australis Aust/NH1
5 199630 199764 + NZ_LR134527.1 Bartonella elizabethae
6 324926 325060 + NC_010161.1 Bartonella tribocorum CIP 105476
7 634697 634831 + NZ_CP031843.2 Bartonella kosoyi
8 1242115 1242231 + NZ_CP058235.1 Bartonella alsatica
9 664858 664986 + NZ_CP010401.1 Bartonella ancashensis
10 172160 172294 + NZ_CP031844.2 Bartonella krasnovii
11 290732 290866 + NZ_AP019773.1 Bartonella quintana
12 1276602 1276718 - NC_008783.1 Bartonella bacilliformis KC583
13 2955975 2956109 - NZ_CP054836.1 Oricola thermophila
14 1251208 1251327 - NZ_CP011971.1 Steroidobacter denitrificans
15 3510120 3510254 - NZ_CP023067.1 Ensifer sojae CCBAU 05684
16 2569797 2569925 - NZ_CP053856.1 Rhizobium pusense
17 2683021 2683149 - NZ_CP061003.1 Agrobacterium tumefaciens
18 5442 5576 - NC_015675.1 Mesorhizobium opportunistum WSM2075
19 687970 688089 + NZ_CP036532.1 Roseitalea porphyridii
20 731177 731305 + NZ_CP015064.1 Mesorhizobium ciceri biovar biserrulae
21 4735 4869 - NZ_CP033507.1 Mesorhizobium jarvisii
22 3392913 3393041 - NZ_CP059896.1 Ciceribacter thiooxidans
23 150251 150379 + NZ_CP013500.1 Rhizobium esperanzae
24 1052750 1052866 - NC_015387.1 Marinithermus hydrothermalis DSM 14884
25 4602 4730 - NZ_CP064063.1 Brucella anthropi
26 151640 151774 + NC_020059.1 Rhizobium tropici CIAT 899
27 5627 5761 - NC_010103.1 Brucella canis ATCC 23365
28 5627 5761 - NC_004310.3 Brucella suis 1330
29 75083 75211 + NZ_LR723670.1 Pseudorhizobium flavum
30 3999067 3999195 + NZ_FO082820.1 Pseudorhizobium banfieldiae
31 5628 5762 - NC_009505.1 Brucella ovis ATCC 25840
32 5627 5761 - NC_013119.1 Brucella microti CCM 4915
33 1997590 1997724 + NC_003317.1 Brucella melitensis bv. 1 str. 16M
34 1998805 1998939 + NC_022905.1 Brucella ceti TE10759-12
35 5627 5761 - NC_007618.1 Brucella abortus 2308
36 580289 580423 + NZ_LT605585.1 Brucella inopinata
37 4422522 4422656 + NZ_HG938353.1 Neorhizobium galegae bv. orientalis str. HAMBI 540
38 587467 587595 - NZ_CP034940.1 Halorubrum ezzemoulense
39 4640 4759 - NZ_CP022604.1 [Ochrobactrum] quorumnocens
40 148533 148661 + NZ_CP020906.1 Rhizobium etli
41 1968907 1969035 + NZ_CP071454.1 Rhizobium lentis
42 146547 146675 + NZ_CP071612.1 Rhizobium bangladeshense
43 3893097 3893231 + NZ_CP050296.1 Mesorhizobium huakuii
44 740475 740615 - NZ_LT593929.1 Propionibacterium freudenreichii
45 3803563 3803682 + NZ_CP015880.1 Ensifer adhaerens
46 1013884 1014012 - NZ_CP049241.1 Rhizobium pseudoryzae
47 5268 5402 - NC_019973.1 Mesorhizobium australicum WSM2073
48 825659 825793 - NZ_CP049250.1 Rhizobium rhizoryzae
49 2763482 2763616 + NZ_CP014766.1 Pontibacter akesuensis
50 1637424 1637558 + NZ_CP015318.1 Mesorhizobium amorphae CCNWGS0123
51 124714 124833 - NZ_CP006877.1 Rhizobium gallicum bv. gallicum R602sp
52 156224 156367 + NC_014664.1 Rhodomicrobium vannielii ATCC 17100
53 2158209 2158337 + NZ_CP048632.1 Rhizobium oryzihabitans
54 46871 47005 + NZ_LT960614.1 Hartmannibacter diazotrophicus
55 2146208 2146342 + NZ_CP053923.1 Defluviicoccus vanus
56 2626003 2626131 + NZ_CP033724.1 Clavibacter michiganensis subsp. michiganensis
57 56628 56762 - NC_017079.1 Caldilinea aerophila DSM 14535 = NBRC 104270
58 1738803 1738922 - NZ_CP063458.1 Humisphaera borealis
59 1735643 1735759 + NZ_CP033914.1 Chryseobacterium shandongense
60 719713 719847 - NZ_CP051774.1 Luteolibacter luteus
61 4783047 4783163 - NZ_CP010429.1 Spirosoma radiotolerans
62 3838826 3838945 + NC_015564.1 Hoyosella subflava DQS3-9A1
63 753378 753494 + NZ_CP007142.1 Gynuella sunshinyii YC6258
64 3957757 3957885 + NZ_CP015421.1 Rhodovulum sulfidophilum
65 1751815 1751931 + NZ_CP051181.1 Thalassobius gelatinovorus
66 347574 347690 + NC_014643.1 Rothia dentocariosa ATCC 17931
67 130290 130418 + NZ_CP026947.1 Corynebacterium yudongzhengii
68 3557157 3557273 + NZ_LT906450.1 Rhodococcus rhodochrous
69 286455 286583 - NZ_CP012507.1 Kocuria palustris
70 422675 422803 - NC_003911.12 Ruegeria pomeroyi DSS-3
71 2228392 2228511 - NZ_CP011801.1 Nitrospira moscoviensis
72 2210441 2210569 + NZ_CP032624.1 Gryllotalpicola protaetiae
73 3410452 3410580 + NZ_CP053562.1 Thioclava electrotropha
74 1171391 1171510 + NC_011832.1 Methanosphaerula palustris E1-9c
75 599040 599156 - NZ_CP034348.1 Roseovarius faecimaris
76 3412549 3412677 + NZ_CP019437.1 Thioclava nitratireducens
77 1139090 1139212 + NZ_CP058595.1 Costertonia aggregata
78 2186483 2186611 - NZ_CP033897.1 Corynebacterium gerontici
79 3163026 3163160 - NZ_CP017940.1 Phyllobacterium zundukense
80 2361499 2361615 + NZ_CP033929.1 Chryseobacterium indoltheticum
81 383916 384044 - NZ_CP034412.1 Glutamicibacter creatinolyticus
82 4263560 4263688 - NZ_LS483468.1 Rhodococcus coprophilus
83 3634355 3634483 + NC_015730.1 Roseobacter litoralis Och 149
84 3901926 3902042 + NC_009719.1 Parvibaculum lavamentivorans DS-1
85 598464 598583 - NZ_CP012661.1 Defluviimonas alba
86 1129863 1130006 - NZ_CP015961.1 Dietzia timorensis
87 2574270 2574398 + NZ_CP014228.1 Actinomyces radicidentis
88 2941575 2941694 - NZ_CP046908.1 Stappia indica
89 49855 49977 - NZ_CP009245.1 Corynebacterium aquilae DSM 44791
90 1291754 1291888 - NZ_CP017146.1 Marisediminicola antarctica
91 1369061 1369189 + NZ_CP020470.1 Rhodobacter blasticus
92 2642836 2642952 - NZ_CP011129.1 Lysobacter antibioticus
93 3428012 3428131 + NZ_CP054599.1 Sulfitobacter pseudonitzschiae
94 1339394 1339513 - NC_014831.1 Thermaerobacter marianensis DSM 12885
95 753764 753883 - NC_014248.1 'Nostoc azollae' 0708
96 636370 636489 - NC_017448.1 Fibrobacter succinogenes subsp. succinogenes S85
97 2271726 2271845 - NC_019748.1 Stanieria cyanosphaera PCC 7437
98 1239926 1240045 - NC_019729.1 Oscillatoria nigro-viridis PCC 7112
99 1900444 1900563 + NZ_CP041242.1 Lysobacter alkalisoli
100 4100330 4100458 - NZ_CP036402.1 Egibacter rhizosphaerae
101 1916720 1916848 - NZ_CP036250.1 Egicoccus halophilus
102 81452 81568 + NC_020453.1 Bradyrhizobium oligotrophicum S58
103 2556454 2556588 + NC_004757.1 Nitrosomonas europaea ATCC 19718
104 1074790 1074906 - NZ_CP015453.1 Dietzia psychralcaliphila
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_HG965802.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00899.23 1.0 104 -128 opposite-strand ThiF family
++ More..