Result : EXP02337
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02337 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 1680451 |
| Right | 1680654 |
| Strand | + |
| Nucleotide Sequence | ATGAAGTTAACAAAAAAAGTGATGCTGATGTGCGTGCTGAGCTCTCTAGTTGGCTGCGCGATAAATAAGCGTTCTTCCTGTGAAGGATGGTTGCCCATTTACTTAGAGAGGAAAGATCTCAATGTCATCAGTGCAAACTTAGCAAGAGAGATCTTAAAACATAACAAACAGGGTGAGTACTTGTGTGGGTGGAAACATGGCTAG |
| Sequence | MKLTKKVMLMCVLSSLVGCAINKRSSCEGWLPIYLERKDLNVISANLAREILKHNKQGEYLCGWKHG |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Total Membrane exclusive. This protein is only found in the uninduced conditions which mimick those encountered in the arthropod vector. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1654949 | 1655152 | + | NZ_HG965802.1 | Bartonella henselae |
| 2 | 373829 | 374032 | - | NZ_HG965802.1 | Bartonella henselae |
| 3 | 369556 | 369774 | + | NZ_HG965802.1 | Bartonella henselae |
| 4 | 1016417 | 1016608 | - | NZ_HG965802.1 | Bartonella henselae |
| 5 | 1006095 | 1006316 | - | NZ_HG965802.1 | Bartonella henselae |
| 6 | 1371713 | 1371928 | + | NZ_AP019773.1 | Bartonella quintana |
| 7 | 378634 | 378837 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 8 | 372416 | 372631 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 9 | 524793 | 524996 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 10 | 2239051 | 2239254 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 11 | 1190780 | 1190983 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 12 | 2219060 | 2219272 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 13 | 745987 | 746202 | + | NZ_CP010401.1 | Bartonella ancashensis |
| 14 | 38605 | 38820 | - | NZ_CP010401.1 | Bartonella ancashensis |
| 15 | 1464721 | 1464936 | - | NZ_CP010401.1 | Bartonella ancashensis |
| 16 | 682931 | 683101 | + | NZ_CP010401.1 | Bartonella ancashensis |
| 17 | 1729350 | 1729553 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 18 | 695773 | 695976 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 19 | 680385 | 680600 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 20 | 1475442 | 1475660 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 21 | 2232631 | 2232837 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 22 | 1636673 | 1636876 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 23 | 810287 | 810490 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 24 | 219987 | 220202 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 25 | 931101 | 931319 | + | NZ_CP031844.2 | Bartonella krasnovii |
| 26 | 1708779 | 1708964 | + | NZ_CP031844.2 | Bartonella krasnovii |
| 27 | 1031138 | 1031356 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 28 | 589742 | 589948 | - | NZ_LR134529.1 | Bartonella vinsonii |
| 29 | 1568189 | 1568395 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 30 | 1883620 | 1883844 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 31 | 1915974 | 1916198 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 32 | 423524 | 423730 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 33 | 1160018 | 1160224 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 34 | 1025717 | 1025923 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 35 | 419969 | 420193 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 36 | 1021233 | 1021457 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 37 | 1022644 | 1022868 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 38 | 1323979 | 1324185 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 39 | 1317888 | 1318112 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 40 | 2044368 | 2044580 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 41 | 726146 | 726364 | + | NZ_CP058235.1 | Bartonella alsatica |
| 42 | 456040 | 456255 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 43 | 785873 | 786094 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 44 | 1225871 | 1226098 | - | NC_008783.1 | Bartonella bacilliformis KC583 |
| 45 | 262337 | 262540 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 46 | 1575911 | 1576117 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 47 | 684041 | 684244 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 48 | 972244 | 972447 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 49 | 1233667 | 1233873 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 50 | 282073 | 282294 | + | NC_020300.1 | Bartonella australis Aust/NH1 |
| 51 | 1186673 | 1186894 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_HG965802.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00959.21 | 0.92 | 11 | 157.0 | same-strand | Phage lysozyme |
++ More..