Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02336 |
NCBI Accession ID | NC_005956.1 |
Organism | Bartonella henselae str. Houston-1 |
Left | 1506024 |
Right | 1506185 |
Strand | + |
Nucleotide Sequence | ATGATGAAATCAGATCTGCAAACATTCATTTCACCCTCCCAACAACGAAAACTTCATATATTTCACGATGTTCTAGAATATATTTTTGTCATTATCATCAATTTAAGCGCTATTTTTGCTGCTCTCATATCCTTTACAGATCAATTTAAGTCCTATTTTTAA |
Sequence | MMKSDLQTFISPSQQRKLHIFHDVLEYIFVIIINLSAIFAALISFTDQFKSYF |
Source of smORF | Protein-level |
Function | The localisation of the protein was found to be: Total Membrane exclusive. Pubmed:29141959 |
Pubmed ID | 29141959 |
Domain | |
Functional Category | Manually curated function from literature |
Uniprot ID | |
ORF Length (Amino Acid) | 53 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1491278 | 1491439 | + | NZ_HG965802.1 | Bartonella henselae |
2 | 555340 | 555501 | + | NZ_CP058235.1 | Bartonella alsatica |
3 | 1679654 | 1679815 | + | NZ_LR134529.1 | Bartonella vinsonii |
4 | 1663779 | 1663940 | + | NC_012846.1 | Bartonella grahamii as4aup |
5 | 1795361 | 1795522 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
6 | 1380334 | 1380495 | + | NZ_CP031844.2 | Bartonella krasnovii |
7 | 1413482 | 1413643 | + | NZ_LR134527.1 | Bartonella elizabethae |
8 | 2056575 | 2056736 | + | NZ_CP031843.2 | Bartonella kosoyi |
9 | 187160 | 187321 | + | NZ_CP010401.1 | Bartonella ancashensis |
10 | 482965 | 483114 | - | NC_014932.1 | Bartonella clarridgeiae 73 |
11 | 1202776 | 1202943 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01656.25 | 0.73 | 8 | 2002.5 | opposite-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
2 | PF04273.15 | 0.91 | 10 | 275.5 | same-strand | Putative phosphatase (DUF442) |
3 | PF06574.14 | 1.0 | 11 | -16 | opposite-strand | FAD synthetase |
4 | PF01687.19 | 1.0 | 11 | -16 | opposite-strand | Riboflavin kinase |
5 | PF13344.8 | 1.0 | 11 | 985 | opposite-strand | Haloacid dehalogenase-like hydrolase |