Result : EXP02334
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02334 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 1365815 |
| Right | 1365937 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATATTACGTAAAATGCCAACAGAACACGAACGCGTTTCAGAAACCAGCACAGATGTTACACCAGTATTGCAAGGCGGTAAACTTGAAAGGAAAGTAAAGAAAAAGGAAAATAAATAG |
| Sequence | MKILRKMPTEHERVSETSTDVTPVLQGGKLERKVKKKENK |
| Source of smORF | Protein-level |
| Function | The localisation of the protein was found to be: Cytoplasmic predominant. Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1351120 | 1351242 | + | NZ_HG965802.1 | Bartonella henselae |
| 2 | 445171 | 445311 | + | NZ_CP058235.1 | Bartonella alsatica |
| 3 | 1149776 | 1149910 | + | NZ_AP019773.1 | Bartonella quintana |
| 4 | 1503034 | 1503165 | + | NZ_LR134529.1 | Bartonella vinsonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_HG965802.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00496.24 | 1.0 | 4 | 4640.0 | opposite-strand | Bacterial extracellular solute-binding proteins, family 5 Middle |
| 2 | PF03352.15 | 1.0 | 4 | 4238.5 | opposite-strand | Methyladenine glycosylase |
| 3 | PF02601.17 | 1.0 | 4 | 2808.0 | opposite-strand | Exonuclease VII, large subunit |
| 4 | PF13742.8 | 1.0 | 4 | 2808.0 | opposite-strand | OB-fold nucleic acid binding domain |
| 5 | PF01336.27 | 1.0 | 4 | 2808.0 | opposite-strand | OB-fold nucleic acid binding domain |
| 6 | PF20061.1 | 0.75 | 3 | 82 | same-strand | Family of unknown function (DUF6460) |
| 7 | PF09608.12 | 1.0 | 4 | 372.0 | opposite-strand | Putative transmembrane protein (Alph Pro TM) |
| 8 | PF01925.21 | 1.0 | 4 | 1184.0 | opposite-strand | Sulfite exporter TauE/SafE |
++ More..