Result : EXP02333
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02333 |
| NCBI Accession ID | NC_005956.1 |
| Organism | Bartonella henselae str. Houston-1 |
| Left | 922641 |
| Right | 922847 |
| Strand | + |
| Nucleotide Sequence | ATGTTTATAAATCATTTAAAAATTATCCAATATATTACAGATATGTCAAAACAAATGAACCAGATGGCGCGTCAAGCGCGAAGTCCTCTTTTAGCATTACTTTTGGATATGGCAGCTAAAGAAGGGCAGAGTATTATTAATAGTGCGGAGGCTCTTGGAGAAGATCAAAATTCGACAATGACACATAACCACCAGAGTGTCGAATAA |
| Sequence | MFINHLKIIQYITDMSKQMNQMARQARSPLLALLLDMAAKEGQSIINSAEALGEDQNSTMTHNHQSVE |
| Source of smORF | Protein-level |
| Function | This protein is differentially expressed 6.5-fold higher in induced condition ( conditions mimicking those encountered in mammalian host) as compared to in the uninduced condition ( conditions mimicking those encountered in arthropod vector). Pubmed:29141959 |
| Pubmed ID | 29141959 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 916773 | 916979 | + | NZ_HG965802.1 | Bartonella henselae |
| 2 | 779644 | 779850 | + | NZ_AP019773.1 | Bartonella quintana |
| 3 | 807095 | 807301 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 4 | 1027152 | 1027358 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 5 | 1571379 | 1571585 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 6 | 1257310 | 1257516 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 7 | 1208972 | 1209178 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 8 | 1604610 | 1604816 | + | NZ_CP058235.1 | Bartonella alsatica |
| 9 | 1933203 | 1933409 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 10 | 778488 | 778694 | + | NC_020300.1 | Bartonella australis Aust/NH1 |
| 11 | 879061 | 879267 | - | NC_014932.1 | Bartonella clarridgeiae 73 |
| 12 | 861376 | 861582 | - | NC_008783.1 | Bartonella bacilliformis KC583 |
| 13 | 1013525 | 1013731 | + | NZ_CP010401.1 | Bartonella ancashensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031843.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00471.22 | 0.92 | 12 | 6659.0 | opposite-strand | Ribosomal protein L33 |
| 2 | PF00773.21 | 1.0 | 13 | 2844 | opposite-strand | RNB domain |
| 3 | PF17876.3 | 0.85 | 11 | 2844 | opposite-strand | Cold shock domain |
| 4 | PF01131.22 | 1.0 | 13 | 263 | opposite-strand | DNA topoisomerase |
| 5 | PF13368.8 | 1.0 | 13 | 263 | opposite-strand | Topoisomerase C-terminal repeat |
| 6 | PF01751.24 | 1.0 | 13 | 263 | opposite-strand | Toprim domain |
| 7 | PF01396.21 | 1.0 | 13 | 263 | opposite-strand | Topoisomerase DNA binding C4 zinc finger |
| 8 | PF02481.17 | 1.0 | 13 | -70 | opposite-strand | DNA recombination-mediator protein A |
| 9 | PF17782.3 | 1.0 | 13 | -70 | opposite-strand | DprA winged helix domain |
| 10 | PF02660.17 | 1.0 | 13 | 1119 | opposite-strand | Glycerol-3-phosphate acyltransferase |
| 11 | PF01979.22 | 0.92 | 12 | 1763.5 | opposite-strand | Amidohydrolase family |
| 12 | PF12890.9 | 0.77 | 10 | 1764.5 | opposite-strand | Dihydro-orotase-like |
| 13 | PF02729.23 | 1.0 | 13 | 3061 | opposite-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
| 14 | PF00185.26 | 1.0 | 13 | 3061 | opposite-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
| 15 | PF18158.3 | 1.0 | 13 | 4152 | same-strand | Adaptive response protein AidB N-terminal domain |
| 16 | PF00565.19 | 0.85 | 11 | 7226 | opposite-strand | Staphylococcal nuclease homologue |
++ More..