Result : EXP02330
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02330 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2724043 |
| Right | 2724342 |
| Strand | - |
| Nucleotide Sequence | ATGTCTTTAAATAAAGAGCAAAGACGCATCACAGCTGAAGAGTTGCAAGCACATTTCGAAGCATCTACCTTATCGGTTCAAATGATTGCTGAAAAACTGAATGTCACTACAGAAGATGTGGAAAAAGTATTAGCTATGACAGCGCCACTAGGCATTTTTAGTCATCAATTACAACGATTTATTCATTTAGTATGGGATGTCAGAGATGTAATAAACGACAATATTAAAGGAAATGGACAAACACCAGAACCATATACGTATTTAAAAGGTGAAAAAGAGGACTATTGGTTTTTAAGATAA |
| Sequence | MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl01805. Profile Description: Uncharacterized protein conserved in bacteria (DUF2316). Members of this family of hypothetical bacterial proteins have no known function. |
| Pubmed ID | 34061833 |
| Domain | CDD:413073 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2666560 | 2666859 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2627615 | 2627914 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 449724 | 450023 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 4 | 1768948 | 1769247 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 2491432 | 2491731 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 6 | 1862158 | 1862457 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 7 | 667985 | 668278 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 8 | 348179 | 348481 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 9 | 1124802 | 1125104 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 10 | 238817 | 239116 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 11 | 1384861 | 1385172 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05979.14 | 0.64 | 7 | 1385 | opposite-strand | Bacterial protein of unknown function (DUF896) |
| 2 | PF18029.3 | 0.64 | 7 | 865 | same-strand | Glyoxalase-like domain |
| 3 | PF00903.27 | 0.73 | 8 | 863.5 | same-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 4 | PF05368.15 | 0.82 | 9 | 18 | same-strand | NmrA-like family |
| 5 | PF13460.8 | 0.82 | 9 | 18 | same-strand | NAD(P)H-binding |
| 6 | PF00440.25 | 0.91 | 10 | 128.5 | opposite-strand | Bacterial regulatory proteins, tetR family |
| 7 | PF00106.27 | 0.82 | 9 | 682 | opposite-strand | short chain dehydrogenase |
| 8 | PF04909.16 | 0.82 | 9 | 1478 | opposite-strand | Amidohydrolase |
| 9 | PF12697.9 | 0.73 | 8 | 2510.0 | opposite-strand | Alpha/beta hydrolase family |
++ More..