Result : EXP02329
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02329 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2731594 |
| Right | 2731890 |
| Strand | - |
| Nucleotide Sequence | ATGGAAACAATAGGAAGCATTATTTATTTAAAAGAAGGTTCGCAAAAGTTAATGATTATTAATAGAGGACCAATTGTAGAAATTGAAAATCAAAAGTATATGTTTGACTATTCTGCATGTAAATATCCGATTGGTGTTGTAGAAGATGAAATTTATTATTTTAACGAGGAAAATATAGATTCAGTTATTTTTAAAGGTTATTCTGATCAAGATGAGGTTAGATTTCAAGAGTTGTTTGAAAATATGAAACAAAATTTGGATAGTGAAATACAACGTGGAGAAGTTACACAACAATAA |
| Sequence | METIGSIIYLKEGSQKLMIINRGPIVEIENQKYMFDYSACKYPIGVVEDEIYYFNEENIDSVIFKGYSDQDEVRFQELFENMKQNLDSEIQRGEVTQQ |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl01867. Profile Description: Domain of unknown function (DUF4176). |
| Pubmed ID | 34061833 |
| Domain | CDD:413100 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2674110 | 2674406 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2635190 | 2635486 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1393344 | 1393658 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 4 | 1398512 | 1398820 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 5 | 986567 | 986878 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 6 | 1885309 | 1885572 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 7 | 2014907 | 2015218 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 8 | 1717053 | 1717364 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 9 | 2100825 | 2101139 | - | NZ_LT906444.1 | Listeria welshimeri |
| 10 | 1966434 | 1966748 | - | NZ_LT906444.1 | Listeria welshimeri |
| 11 | 1057394 | 1057702 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 12 | 2551598 | 2551894 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 13 | 780901 | 781194 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 14 | 783577 | 783879 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 15 | 1083646 | 1083921 | - | NZ_LS483343.1 | Streptococcus ferus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022096.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04276.14 | 0.83 | 10 | 673 | same-strand | Protein of unknown function (DUF443) |
++ More..