Result : EXP02327
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02327 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2212576 |
| Right | 2212869 |
| Strand | - |
| Nucleotide Sequence | ATGACTGAACAAGATAATGCACATCATTCTGAACAAATAAAAACGAATCTTAAATCACGTTTAAATCGAATTGAAGGACAAGTGAGAGCGATTAATCGCATGATTGAAGAAGATGTCTATTGTGATGATGTCCTTACGCAAATAAGAGCGACACGTTCGGCGTTAAACAGTGTTGCGATAAAGTTATTAGAACAACATATGAAAAGTTGTATTATGAATAAAGTTAATCAAGGTGCTCAGGAAGAGGCAATGGAAGAGTTATTAGTGACTTTTCAAAAATTGATTAAAGACTAA |
| Sequence | MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVLTQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00846. Profile Description: Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156. This is a family of metal-sensitive repressors, involved in resistance to metal ions. Members of this family bind copper, nickel or cobalt ions via conserved cysteine and histidine residues. In the absence of metal ions, these proteins bind to promoter regions and repress transcription. When bound to metal ions they are unable to bind DNA, leading to transcriptional derepression. |
| Pubmed ID | 34061833 |
| Domain | CDD:412603 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 115
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2154917 | 2155210 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2110737 | 2111030 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2024285 | 2024578 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 837315 | 837608 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 5 | 592238 | 592531 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 88905 | 89198 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 7 | 1308471 | 1308764 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 8 | 914707 | 915000 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 9 | 1657757 | 1658050 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 10 | 877823 | 878116 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 11 | 1624848 | 1625141 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 12 | 68566 | 68859 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 13 | 2054428 | 2054721 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 14 | 1031891 | 1032184 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 15 | 1856123 | 1856416 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 16 | 913676 | 913969 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 17 | 856148 | 856441 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 18 | 725998 | 726291 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 19 | 2388562 | 2388855 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 20 | 20114 | 20401 | - | NZ_CP027770.1 | Staphylococcus felis |
| 21 | 887044 | 887337 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 22 | 1830398 | 1830685 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 23 | 489267 | 489554 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 24 | 826695 | 826982 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 25 | 1647796 | 1648083 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 26 | 925131 | 925376 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 27 | 1599411 | 1599698 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 28 | 4795298 | 4795576 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 29 | 3927102 | 3927401 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 30 | 699712 | 699966 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 31 | 206563 | 206886 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 32 | 872967 | 873248 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 33 | 1290359 | 1290613 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 34 | 4304939 | 4305190 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 35 | 1122580 | 1122822 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 36 | 577418 | 577750 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 37 | 211622 | 211861 | + | NZ_LS483476.1 | Lederbergia lentus |
| 38 | 38378 | 38632 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 39 | 40560 | 40814 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 40 | 4447 | 4701 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 41 | 689628 | 689867 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 42 | 4794609 | 4794863 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 43 | 4191044 | 4191283 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 44 | 331994 | 332311 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 45 | 2214840 | 2215082 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 46 | 2488898 | 2489152 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 47 | 3795176 | 3795484 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 48 | 1813540 | 1813848 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 49 | 633580 | 633867 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 50 | 3114128 | 3114364 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 51 | 184818 | 185054 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 52 | 1651347 | 1651586 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 53 | 232502 | 232813 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 54 | 4093580 | 4093906 | - | NZ_CP053989.1 | Niallia circulans |
| 55 | 4053333 | 4053584 | - | NZ_AP019400.1 | Cohnella abietis |
| 56 | 546137 | 546376 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 57 | 1967732 | 1968046 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 58 | 1395396 | 1395650 | - | NZ_CP021434.1 | Tumebacillus avium |
| 59 | 1068979 | 1069218 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 60 | 535351 | 535593 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 61 | 516350 | 516649 | - | NZ_CP059540.1 | Planococcus maritimus |
| 62 | 208576 | 208818 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 63 | 3295105 | 3295344 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 64 | 1609313 | 1609630 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 65 | 5769631 | 5769870 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 66 | 1849779 | 1850030 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 67 | 514270 | 514512 | - | NZ_CP016538.2 | Planococcus maritimus |
| 68 | 6056688 | 6056927 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 69 | 435458 | 435697 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 70 | 619176 | 619484 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 71 | 485159 | 485488 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 72 | 2801606 | 2801863 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 73 | 8237250 | 8237486 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 74 | 6671482 | 6671721 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 75 | 3973400 | 3973651 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 76 | 2609412 | 2609723 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 77 | 4748729 | 4748965 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 78 | 4631719 | 4631955 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 79 | 641206 | 641457 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 80 | 2326767 | 2327048 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 81 | 1253101 | 1253343 | + | NZ_CP013661.2 | Planococcus kocurii |
| 82 | 511925 | 512167 | - | NZ_CP019401.1 | Planococcus faecalis |
| 83 | 670312 | 670611 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 84 | 538454 | 538696 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 85 | 572752 | 573078 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 86 | 3523721 | 3524044 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 87 | 1156434 | 1156688 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 88 | 503396 | 503719 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 89 | 502760 | 503083 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 90 | 2217311 | 2217562 | + | NZ_CP034118.1 | Staphylospora marina |
| 91 | 3308606 | 3308848 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 92 | 2198913 | 2199227 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 93 | 1610853 | 1611131 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 94 | 4990505 | 4990744 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 95 | 3180568 | 3180867 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 96 | 3025472 | 3025789 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 97 | 2037266 | 2037532 | + | NZ_CP026363.1 | Brevibacillus agri |
| 98 | 1216652 | 1216987 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 99 | 2084795 | 2085034 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 100 | 2235769 | 2236056 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 101 | 1767265 | 1767504 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 102 | 2784018 | 2784257 | + | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
| 103 | 1481654 | 1481932 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 104 | 3880589 | 3880879 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 105 | 4730187 | 4730486 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 106 | 1063725 | 1063964 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 107 | 273421 | 273702 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 108 | 2174351 | 2174659 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 109 | 4985590 | 4985880 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 110 | 2270359 | 2270625 | + | NZ_CP019875.1 | Komagataeibacter nataicola |
| 111 | 1436445 | 1436750 | + | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 112 | 3939561 | 3939800 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 113 | 1962457 | 1962717 | - | NZ_CP017707.1 | Chromobacterium vaccinii |
| 114 | 187762 | 188061 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 115 | 6198540 | 6198839 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 116 | 748400 | 748678 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 117 | 186114 | 186431 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 118 | 3035976 | 3036275 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 119 | 4322882 | 4323205 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 120 | 754141 | 754461 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 121 | 3282584 | 3282874 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 122 | 104860 | 105141 | + | NZ_CP007287.1 | Bifidobacterium coryneforme |
| 123 | 1358753 | 1359037 | + | NZ_LT635457.1 | Actinomyces pacaensis |
| 124 | 110755 | 111036 | + | NZ_CP006018.1 | Bifidobacterium indicum LMG 11587 = DSM 20214 |
| 125 | 390056 | 390292 | + | NZ_CP016379.1 | Anoxybacter fermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033460.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00403.28 | 0.7 | 80 | 238.5 | same-strand | Heavy-metal-associated domain |
| 2 | PF00122.22 | 0.61 | 70 | 315 | same-strand | E1-E2 ATPase |
| 3 | PF00702.28 | 0.61 | 70 | 315 | same-strand | haloacid dehalogenase-like hydrolase |
++ More..