Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02326 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 1976532 |
Right | 1976822 |
Strand | - |
Nucleotide Sequence | ATGTCTGAGCCAGAATTAAGACACGAAATACAACTTTATAAAGAGAAAATGAGAAAAGCTGAGATGAATGGTATTTTAAATGAATATGACGTTTATCAAAGTAAAGTAATTGTTGCCGAAAGTTACTTAGTAGACAGAAAAAAGATAGAAATTGGTAAAATTTATAAACTGACTGATGGCAGTAATCAATATTTTAAAGTAGAAAGATTAAAAGGTATTTTTGCGTGGGGGTTTAGATTTAATAGCGATGAACCCGAAGAAGGATTACCTATAGCGTTATTACAATTATAG |
Sequence | MSEPELRHEIQLYKEKMRKAEMNGILNEYDVYQSKVIVAESYLVDRKKIEIGKIYKLTDGSNQYFKVERLKGIFAWGFRFNSDEPEEGLPIALLQL |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of pfam08838. Profile Description: Protein of unknown function (DUF1811). This is a bacterial family of uncharacterized proteins. Some of the proteins are annotated as being transcriptional regulators. The structure of one of the proteins in this family has revealed a beta-barrel like structure with helix-turn-helix like motif. |
Pubmed ID | 34061833 |
Domain | CDD:400958 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1919801 | 1920091 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1963418 | 1963708 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 1878755 | 1879045 | - | NZ_LT906460.1 | Staphylococcus simiae |
4 | 973313 | 973603 | + | NZ_LR134242.1 | Staphylococcus warneri |
5 | 455192 | 455482 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
6 | 1181883 | 1182173 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
7 | 1066132 | 1066422 | + | NZ_AP018587.1 | Staphylococcus caprae |
8 | 1007378 | 1007668 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
9 | 1002979 | 1003269 | + | NZ_CP064056.1 | Staphylococcus lloydii |
10 | 191336 | 191626 | + | NZ_CP018199.1 | Staphylococcus succinus |
11 | 1043293 | 1043583 | + | NZ_CP008724.1 | Staphylococcus xylosus |
12 | 978082 | 978372 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
13 | 1739329 | 1739619 | + | NZ_CP033732.1 | Staphylococcus hominis |
14 | 1527221 | 1527511 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
15 | 796577 | 796867 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
16 | 848796 | 849086 | + | NZ_CP065712.1 | Staphylococcus auricularis |
17 | 1735947 | 1736237 | - | NZ_CP013114.1 | Staphylococcus equorum |
18 | 2526574 | 2526864 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
19 | 1689792 | 1690082 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
20 | 1173439 | 1173729 | + | NZ_CP018776.1 | Staphylococcus condimenti |
21 | 2368197 | 2368487 | - | NZ_CP027770.1 | Staphylococcus felis |
22 | 1464514 | 1464804 | - | NZ_LT906464.1 | Staphylococcus muscae |
23 | 347235 | 347525 | - | NZ_CP020773.1 | Staphylococcus lutrae |
24 | 1924007 | 1924297 | - | NZ_CP033460.1 | Staphylococcus debuckii |
25 | 949928 | 950215 | + | NZ_CP008747.1 | Staphylococcus hyicus |
26 | 736207 | 736497 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
27 | 818611 | 818901 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
28 | 1904722 | 1905018 | - | NZ_CP054482.1 | Macrococcus bohemicus |
29 | 1416386 | 1416676 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
30 | 1525741 | 1526028 | - | NZ_CP045927.1 | Staphylococcus agnetis |
31 | 1841970 | 1842260 | - | NZ_CP047361.1 | Macrococcus canis |
32 | 1324670 | 1324960 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
33 | 398793 | 399083 | + | NZ_CP019573.1 | Abyssicoccus albus |
34 | 1929163 | 1929402 | - | NZ_CP011366.1 | Salinicoccus halodurans |
35 | 781091 | 781396 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
36 | 95367 | 95672 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
37 | 805811 | 806116 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04167.15 | 1.0 | 37 | 4675 | same-strand | Protein of unknown function (DUF402) |
2 | PF14815.8 | 1.0 | 37 | 3542 | same-strand | NUDIX domain |
3 | PF00730.27 | 0.97 | 36 | 3543.0 | same-strand | HhH-GPD superfamily base excision DNA repair protein |
4 | PF00633.25 | 0.62 | 23 | 3540 | same-strand | Helix-hairpin-helix motif |
5 | PF04307.16 | 1.0 | 37 | 2455 | opposite-strand | LexA-binding, inner membrane-associated putative hydrolase |
6 | PF00005.29 | 0.68 | 25 | 16 | same-strand | ABC transporter |
7 | PF02631.18 | 1.0 | 37 | 14 | same-strand | RecX family |
8 | PF00912.24 | 0.86 | 32 | 995.0 | same-strand | Transglycosylase |
9 | PF01965.26 | 0.86 | 32 | 2229.5 | same-strand | DJ-1/PfpI family |