Result : EXP02325
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02325 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 858843 |
| Right | 859127 |
| Strand | - |
| Nucleotide Sequence | TTGAATGAACTAACTAAAGAACAAAAGTATACAATAGCTAAATTTTACAAATTATATATTGAACGTTCGAATAAAGGAGAAACAGAAACAGTCGCTAACTTTTTTGGCGATGCTAAAGATGCACGTGAAAACTATTTTTGCGATCGTGATTATCAAGACTTCTTAACTAACTGCCAAATTTTAATTCAAAACAAATACTTAACTGGTGAAGTTTTGGACGATAACATTTACAATATTTCTATTTTAAACAAGACATTTATTGAATTCGAACAAAATTTTGGTTGA |
| Sequence | LNELTKEQKYTIAKFYKLYIERSNKGETETVANFFGDAKDARENYFCDRDYQDFLTNCQILIQNKYLTGEVLDDNIYNISILNKTFIEFEQNFG |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 802053 | 802337 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 871193 | 871477 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 820440 | 820724 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 926219 | 926503 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 5 | 569226 | 569513 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 6 | 435878 | 436162 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 7 | 1995276 | 1995560 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 8 | 2124171 | 2124455 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 9 | 1388390 | 1388674 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 10 | 160291 | 160575 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 11 | 2021402 | 2021686 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 12 | 1915025 | 1915309 | + | NZ_LR134242.1 | Staphylococcus warneri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP035288.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00313.24 | 0.75 | 9 | 1415 | opposite-strand | 'Cold-shock' DNA-binding domain |
| 2 | PF05908.13 | 0.75 | 9 | 91 | same-strand | Poly-gamma-glutamate hydrolase |
++ More..