Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02324 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 373621 |
Right | 373905 |
Strand | - |
Nucleotide Sequence | ATGAAAATTTTAGTAGTATGTGGCCACGGTTTAGGAAGTAGTTTTATGGTAGAAATGAACGCACAAGAAGCACTTAGGCAACTTAATGCACCATCTGATATCGAAGTTGAACATAGTGACATTATGACAGCAAGTCCAGAGATGGCTGACTTGTTTATTTGTGGTAGAGATTTAGCTGAAAATGCCGAACGTCTAGGGGATGTCTTAGTTCTTGATAATATTTTAGATAAAGCTGAATTACAACAAAAGCTCTCAGAAAAATTACAACAACTTAACATGATTTAA |
Sequence | MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTASPEMADLFICGRDLAENAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl10014. Profile Description: N/A. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIB PTS system cytoplasmic enzymes. The fold of IIB cellobiose shows similar structure to mammalian tyrosine phosphatases. This family also contains the fructose specific IIB subunit. |
Pubmed ID | 34061833 |
Domain | CDD:415825 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 325937 | 326221 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 327802 | 328086 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 2063891 | 2064175 | - | NZ_LT906464.1 | Staphylococcus muscae |
4 | 2280194 | 2280478 | + | NZ_CP018199.1 | Staphylococcus succinus |
5 | 283008 | 283292 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
6 | 2173359 | 2173643 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
7 | 2147618 | 2147902 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
8 | 465663 | 465947 | + | NZ_CP064056.1 | Staphylococcus lloydii |
9 | 2408005 | 2408289 | - | NZ_CP013114.1 | Staphylococcus equorum |
10 | 20093 | 20377 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
11 | 322760 | 323044 | + | NZ_CP008724.1 | Staphylococcus xylosus |
12 | 2185725 | 2186009 | - | NZ_CP045927.1 | Staphylococcus agnetis |
13 | 310443 | 310727 | + | NZ_CP008747.1 | Staphylococcus hyicus |
14 | 1718434 | 1718718 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
15 | 2393384 | 2393668 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
16 | 1060595 | 1060879 | - | NZ_CP020773.1 | Staphylococcus lutrae |
17 | 942371 | 942652 | - | NZ_CP022437.1 | Virgibacillus necropolis |
18 | 3485723 | 3486004 | - | NZ_CP024035.1 | Priestia aryabhattai |
19 | 3552787 | 3553068 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
20 | 4212861 | 4213142 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
21 | 500117 | 500398 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
22 | 556433 | 556714 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
23 | 514064 | 514360 | + | NZ_CP025198.1 | Acidipropionibacterium virtanenii |
24 | 333536 | 333817 | + | NZ_CP017267.1 | Vagococcus teuberi |
25 | 1981744 | 1982025 | - | NZ_CP054938.1 | Streptomyces harbinensis |
26 | 3201218 | 3201490 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
27 | 3921331 | 3921612 | + | NZ_CP031194.1 | Streptomyces paludis |
28 | 2160327 | 2160608 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
29 | 1653490 | 1653774 | + | NZ_CP071376.1 | Clostridium gasigenes |
30 | 70919 | 71200 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
31 | 1343884 | 1344156 | + | NZ_CP023525.1 | Cedecea neteri |
32 | 1304957 | 1305229 | + | NZ_LR134201.1 | Cedecea lapagei |
33 | 4461115 | 4461396 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03611.16 | 1.0 | 33 | 23.5 | same-strand | PTS system sugar-specific permease component |
2 | PF00359.24 | 1.0 | 33 | 17 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
3 | PF00874.22 | 0.76 | 25 | 450 | same-strand | PRD domain |