Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02323 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 887916 |
Right | 888182 |
Strand | - |
Nucleotide Sequence | ATGATTGATATGTATTTATATGATGACAACGAAGAGAGTCAAGTTCAGTTTGTTGGTTTTGTTGGCGAGCATAGTCGATATGATTTGATGTTAGTCCATACAAATAGACATTATGGTAAGACACTCGTACTTAATATGCAAACAAATAAATTCGGTATTATCGGTACTGATGATTTAAAAGAAGAAGGCTATATCGCTCATATTTTAGGTGTAAATGCTGAAGAAGGCGATGAAATTACTGAGTATTTAAATGAAGTCATTCATTAA |
Sequence | MIDMYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQTNKFGIIGTDDLKEEGYIAHILGVNAEEGDEITEYLNEVIH |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of pfam11256. Profile Description: Protein of unknown function (DUF3055). This family of proteins with unknown function appear to be restricted to Firmicutes. |
Pubmed ID | 34061833 |
Domain | CDD:402718 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 831126 | 831392 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 900176 | 900442 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 189022 | 189288 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
4 | 2091043 | 2091309 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
5 | 1888046 | 1888312 | + | NZ_LR134242.1 | Staphylococcus warneri |
6 | 1227907 | 1228173 | + | NZ_CP018199.1 | Staphylococcus succinus |
7 | 850918 | 851184 | - | NZ_LT906460.1 | Staphylococcus simiae |
8 | 2075132 | 2075398 | + | NZ_AP018587.1 | Staphylococcus caprae |
9 | 600543 | 600809 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
10 | 720704 | 720970 | - | NZ_CP013114.1 | Staphylococcus equorum |
11 | 1966810 | 1967076 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
12 | 2013189 | 2013455 | + | NZ_CP008724.1 | Staphylococcus xylosus |
13 | 1417727 | 1417993 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
14 | 1919506 | 1919772 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
15 | 865710 | 865976 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
16 | 1368844 | 1369110 | - | NZ_CP027770.1 | Staphylococcus felis |
17 | 632418 | 632684 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
18 | 1764368 | 1764634 | + | NZ_CP065712.1 | Staphylococcus auricularis |
19 | 2397870 | 2398136 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
20 | 1856855 | 1857121 | - | NZ_CP020773.1 | Staphylococcus lutrae |
21 | 520996 | 521262 | - | NZ_CP045927.1 | Staphylococcus agnetis |
22 | 1916123 | 1916389 | + | NZ_CP064056.1 | Staphylococcus lloydii |
23 | 557513 | 557779 | - | NZ_LT906464.1 | Staphylococcus muscae |
24 | 948707 | 949000 | - | NZ_CP033460.1 | Staphylococcus debuckii |
25 | 411464 | 411730 | + | NZ_CP033732.1 | Staphylococcus hominis |
26 | 1992451 | 1992720 | + | NZ_CP008747.1 | Staphylococcus hyicus |
27 | 2163697 | 2163990 | + | NZ_CP018776.1 | Staphylococcus condimenti |
28 | 1826411 | 1826680 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
29 | 336174 | 336443 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
30 | 1909360 | 1909629 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
31 | 776030 | 776293 | - | NZ_CP054482.1 | Macrococcus bohemicus |
32 | 598719 | 598985 | - | NZ_CP011366.1 | Salinicoccus halodurans |
33 | 1023405 | 1023668 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
34 | 1313272 | 1313538 | + | NZ_CP019573.1 | Abyssicoccus albus |
35 | 707849 | 708112 | - | NZ_CP047361.1 | Macrococcus canis |
36 | 719536 | 719772 | - | NZ_CP012502.1 | Bacillus beveridgei |
37 | 3619895 | 3620161 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
38 | 3544377 | 3544643 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
39 | 2875982 | 2876248 | - | NZ_CP022983.1 | Cytobacillus kochii |
40 | 3243122 | 3243388 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
41 | 822311 | 822583 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01904.20 | 0.71 | 29 | 3861 | opposite-strand | Protein of unknown function DUF72 |
2 | PF01925.21 | 0.78 | 32 | 3030.5 | opposite-strand | Sulfite exporter TauE/SafE |
3 | PF00149.30 | 0.8 | 33 | 1653 | opposite-strand | Calcineurin-like phosphoesterase |
4 | PF04055.23 | 0.93 | 38 | 667 | opposite-strand | Radical SAM superfamily |
5 | PF06265.13 | 0.98 | 40 | 119.5 | opposite-strand | Protein of unknown function (DUF1027) |
6 | PF01934.19 | 0.8 | 33 | 106 | opposite-strand | Protein of unknown function DUF86 |
7 | PF13344.8 | 0.98 | 40 | 538.0 | opposite-strand | Haloacid dehalogenase-like hydrolase |
8 | PF13242.8 | 0.98 | 40 | 538.0 | opposite-strand | HAD-hyrolase-like |
9 | PF00702.28 | 0.95 | 39 | 537 | opposite-strand | haloacid dehalogenase-like hydrolase |
10 | PF02826.21 | 0.85 | 35 | 1343 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
11 | PF00389.32 | 0.85 | 35 | 1343 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |