Result : EXP02322
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02322 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2591865 |
| Right | 2592131 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAATTACACGGTTAAGATTAAAAATTCAGCGAAATCAGATTTAAAGAAAATAAAACATTCTTATTTAAAGAAGTCATTTTTAGAAATTGTTGAGACTTTAAAAAATGATCCGTATAAAATAACACAATCTTTTGAAAAATTAGAGCCTAAATATTTAGAGCGATATTCAAGAAGAATTAACCATCAGCACAGGGTCGTCTATACCGTAGATGATCGAAATAAAGAAGTATTAATACTATCGGCATGGTCACATTATGATTAA |
| Sequence | MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLILSAWSHYD |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl21503. Profile Description: ParE toxin of type II toxin-antitoxin system, parDE. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604. |
| Pubmed ID | 34061833 |
| Domain | CDD:419697 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2534034 | 2534300 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2492936 | 2493202 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 23543 | 23809 | + | NZ_CP007602.1 | Staphylococcus capitis subsp. capitis |
| 4 | 216353 | 216619 | + | NZ_CP065211.1 | Enterococcus lactis |
| 5 | 188805 | 189071 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 6 | 883265 | 883531 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 7 | 1097912 | 1098181 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 8 | 2439955 | 2440221 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 9 | 928 | 1200 | - | NC_020208.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 10 | 451671 | 451937 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 11 | 154632 | 154898 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 12 | 24773 | 25087 | - | NZ_CP032758.1 | Lactiplantibacillus pentosus |
| 13 | 37042 | 37356 | - | NZ_CP019984.1 | Pediococcus inopinatus |
| 14 | 22489 | 22803 | - | NZ_CP019984.1 | Pediococcus inopinatus |
| 15 | 7886 | 8200 | - | NZ_CP019984.1 | Pediococcus inopinatus |
| 16 | 2087213 | 2087527 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 17 | 1828649 | 1828966 | - | NZ_CP014324.1 | Oenococcus oeni |
| 18 | 842128 | 842427 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 19 | 144301 | 144555 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 20 | 1724077 | 1724343 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 21 | 1048832 | 1049095 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02604.21 | 0.88 | 15 | 0.0 | same-strand | Antitoxin Phd YefM, type II toxin-antitoxin system |
++ More..