Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02321 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 413871 |
Right | 414134 |
Strand | - |
Nucleotide Sequence | ATGAATATGCATATTTTATATAACTTACGAACTAAACATAATTTAGAAATTGACGAATTAGCACAGCAATTAAATGAGAAATATGGTACTAAATATGAAGCACATCAAATTTGGGAATGGGAGAATCATCACCATGAACCTAAATTTAAAGATGCCATGCATTTAGCTGACTTCTTTGATGCACCATATGAAATGTTTTTAGAAAGTAAGGTTAAAGAATATCAGAAACATTTAGAAGAAGTCGATATTCGCATGGATAAATAG |
Sequence | MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFDAPYEMFLESKVKEYQKHLEEVDIRMDK |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
Pubmed ID | 34061833 |
Domain | CDD:419869 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 366133 | 366396 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 367513 | 367776 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 390900 | 391157 | - | NZ_LT906460.1 | Staphylococcus simiae |
4 | 2199092 | 2199349 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
5 | 2543963 | 2544220 | + | NZ_AP018587.1 | Staphylococcus caprae |
6 | 977552 | 977809 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
7 | 1358722 | 1358979 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
8 | 56892 | 57149 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04226.15 | 1.0 | 8 | 622.5 | opposite-strand | Transglycosylase associated protein |
2 | PF00300.24 | 0.62 | 5 | 1315 | opposite-strand | Histidine phosphatase superfamily (branch 1) |