Result : EXP02321
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02321 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 413871 |
| Right | 414134 |
| Strand | - |
| Nucleotide Sequence | ATGAATATGCATATTTTATATAACTTACGAACTAAACATAATTTAGAAATTGACGAATTAGCACAGCAATTAAATGAGAAATATGGTACTAAATATGAAGCACATCAAATTTGGGAATGGGAGAATCATCACCATGAACCTAAATTTAAAGATGCCATGCATTTAGCTGACTTCTTTGATGCACCATATGAAATGTTTTTAGAAAGTAAGGTTAAAGAATATCAGAAACATTTAGAAGAAGTCGATATTCGCATGGATAAATAG |
| Sequence | MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFDAPYEMFLESKVKEYQKHLEEVDIRMDK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 34061833 |
| Domain | CDD:419869 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 366133 | 366396 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 367513 | 367776 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 390900 | 391157 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 2199092 | 2199349 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 2543963 | 2544220 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 6 | 977552 | 977809 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 7 | 1358722 | 1358979 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 8 | 56892 | 57149 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04226.15 | 1.0 | 8 | 622.5 | opposite-strand | Transglycosylase associated protein |
| 2 | PF00300.24 | 0.62 | 5 | 1315 | opposite-strand | Histidine phosphatase superfamily (branch 1) |
++ More..