Result : B4RU89
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein MADE_1012200 |
| NCBI Accession ID | CP001103.3 |
| Organism | Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) |
| Left | 2779405 |
| Right | 2779701 |
| Strand | - |
| Nucleotide Sequence | ATGTTATGCGCTGTTTATAAAACGCGAAAAAAAGAGGGCATGTACTTATACTTGCCCAAAAAAGACAATTTTGCAGATGTCCCCGAACCTTTGATGGAAATGTTTGGTCGTCCAGAGCTAGTGACGATTCTTGCACTCGATAAGCGTGAGCGTTTAGGTTTAGTCGATAAGCAAAAGTTAATTGATGAACTTACCGAGAAAGGATTTTACTTGCAGATGCCTCCAAAGGAAGAGAACTTGCTTGAAACGCACCGCGAGTCGCTTGGCCTTTCTAAAACGCCTGATAAGAAATTCTAA |
| Sequence | MLCAVYKTRKKEGMYLYLPKKDNFADVPEPLMEMFGRPELVTILALDKRERLGLVDKQKLIDELTEKGFYLQMPPKEENLLETHRESLGLSKTPDKKF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | 18670397 |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | B4RU89 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 81
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2693694 | 2693990 | - | NZ_CP046670.1 | Alteromonas mediterranea |
| 2 | 1101945 | 1102241 | + | NC_015554.1 | Alteromonas naphthalenivorans |
| 3 | 2692582 | 2692875 | - | NZ_CP008849.1 | Alteromonas australica |
| 4 | 2994206 | 2994502 | - | NZ_CP014322.1 | Alteromonas addita |
| 5 | 2804037 | 2804336 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 6 | 1554620 | 1554919 | + | NZ_CP036536.1 | Salinimonas lutimaris |
| 7 | 3697505 | 3697798 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
| 8 | 1862497 | 1862775 | - | NZ_CP020373.1 | Shewanella khirikhana |
| 9 | 2462323 | 2462619 | - | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 10 | 2357226 | 2357504 | - | NC_008700.1 | Shewanella amazonensis SB2B |
| 11 | 2279841 | 2280119 | - | NZ_CP069213.1 | Shewanella litorisediminis |
| 12 | 2070481 | 2070759 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 13 | 880604 | 880882 | - | NZ_CP009889.1 | Pseudoalteromonas piratica |
| 14 | 1923025 | 1923306 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 15 | 4453144 | 4453467 | + | NZ_CP036200.1 | Shewanella maritima |
| 16 | 2729075 | 2729353 | + | NZ_CP037952.1 | Parashewanella spongiae |
| 17 | 784421 | 784699 | + | NZ_CP011040.1 | Pseudoalteromonas spongiae UST010723-006 |
| 18 | 745280 | 745558 | + | NZ_CP044060.1 | Aeromonas veronii |
| 19 | 2272076 | 2272354 | + | NC_016901.1 | Shewanella baltica OS678 |
| 20 | 914424 | 914702 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 21 | 2543261 | 2543542 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 22 | 2194045 | 2194326 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 23 | 1615220 | 1615510 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 24 | 2389418 | 2389699 | - | NZ_AP014635.1 | Vibrio tritonius |
| 25 | 1902782 | 1903063 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 26 | 3029194 | 3029472 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 27 | 1950485 | 1950763 | + | NZ_CP041036.1 | Shewanella polaris |
| 28 | 2453458 | 2453739 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 29 | 1893714 | 1894001 | + | NC_007954.1 | Shewanella denitrificans OS217 |
| 30 | 2590237 | 2590518 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 31 | 1033321 | 1033599 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 32 | 2714234 | 2714512 | - | NZ_CP020472.1 | Shewanella japonica |
| 33 | 2045207 | 2045485 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 34 | 1265395 | 1265670 | - | NZ_LR134167.1 | Avibacterium volantium |
| 35 | 2465577 | 2465867 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 36 | 1962364 | 1962642 | + | NZ_CP037951.1 | Parashewanella tropica |
| 37 | 2390125 | 2390406 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 38 | 984560 | 984841 | + | NZ_CP013188.1 | Pseudoalteromonas phenolica |
| 39 | 2987344 | 2987625 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 40 | 1416112 | 1416393 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 41 | 1042132 | 1042413 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 42 | 3063206 | 3063487 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 43 | 2829129 | 2829410 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 44 | 1966017 | 1966295 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 45 | 2288391 | 2288678 | + | NZ_CP046378.1 | Shewanella algae |
| 46 | 2747621 | 2747902 | - | NC_013456.1 | Vibrio antiquarius |
| 47 | 1003011 | 1003301 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 48 | 661767 | 662048 | + | NZ_CP011031.1 | Pseudoalteromonas issachenkonii |
| 49 | 662047 | 662328 | + | NZ_CP011042.1 | Pseudoalteromonas tetraodonis |
| 50 | 2283211 | 2283489 | + | NZ_AP022188.1 | Aeromonas media |
| 51 | 1766184 | 1766474 | - | NZ_CP033078.1 | Vibrio zhugei |
| 52 | 1822543 | 1822815 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 53 | 2354712 | 2354996 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 54 | 2616501 | 2616782 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 55 | 585485 | 585766 | + | NZ_CP072135.1 | Pseudoalteromonas xiamenensis |
| 56 | 1073754 | 1074035 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 57 | 2011123 | 2011407 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 58 | 1636899 | 1637177 | - | NZ_CP035688.1 | Vibrio metoecus |
| 59 | 908428 | 908718 | + | NC_011753.2 | Vibrio atlanticus |
| 60 | 870254 | 870535 | + | NZ_CP030788.1 | Vibrio campbellii |
| 61 | 1114118 | 1114399 | + | NZ_CP009467.1 | Vibrio harveyi |
| 62 | 2309690 | 2309977 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 63 | 915447 | 915728 | - | NZ_CP019959.1 | Vibrio owensii |
| 64 | 2210904 | 2211188 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 65 | 2167050 | 2167325 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 66 | 1323665 | 1323946 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 67 | 923500 | 923790 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 68 | 1950178 | 1950459 | - | NZ_AP019657.1 | Vibrio ponticus |
| 69 | 573526 | 573807 | + | NC_007482.1 | Pseudoalteromonas translucida |
| 70 | 616823 | 617104 | + | NZ_CP011037.1 | Pseudoalteromonas nigrifaciens |
| 71 | 1851508 | 1851789 | + | NZ_LR134531.1 | Pragia fontium |
| 72 | 3025733 | 3026005 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 73 | 67331 | 67618 | - | NZ_CP027524.1 | Pseudoalteromonas carrageenovora |
| 74 | 1945146 | 1945421 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 75 | 1230371 | 1230661 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 76 | 1366498 | 1366773 | + | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 77 | 1341711 | 1341992 | + | NZ_CP046268.1 | Vibrio spartinae |
| 78 | 392499 | 392780 | - | NZ_CP072426.1 | Pseudoalteromonas viridis |
| 79 | 2427603 | 2427881 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 80 | 1797677 | 1797958 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 81 | 2472824 | 2473099 | - | NZ_CP031560.1 | Dickeya dianthicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP020373.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13406.8 | 0.91 | 74 | 28.0 | same-strand | Transglycosylase SLT domain |
| 2 | PF01612.22 | 0.78 | 63 | 2013 | same-strand | 3'-5' exonuclease |
| 3 | PF00570.25 | 0.79 | 64 | 2013.5 | same-strand | HRDC domain |
| 4 | PF00501.30 | 0.73 | 59 | 3192 | same-strand | AMP-binding enzyme |
| 5 | PF13193.8 | 0.73 | 59 | 3192 | same-strand | AMP-binding enzyme C-terminal domain |
| 6 | PF03775.18 | 0.84 | 68 | 137.0 | opposite-strand | Septum formation inhibitor MinC, C-terminal domain |
| 7 | PF05209.15 | 0.84 | 68 | 137.0 | opposite-strand | Septum formation inhibitor MinC, N-terminal domain |
| 8 | PF13614.8 | 0.84 | 68 | 849.5 | opposite-strand | AAA domain |
| 9 | PF01656.25 | 0.84 | 68 | 849.5 | opposite-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 10 | PF10609.11 | 0.74 | 60 | 850.0 | opposite-strand | NUBPL iron-transfer P-loop NTPase |
| 11 | PF03776.16 | 0.84 | 68 | 1663.5 | opposite-strand | Septum formation topological specificity factor MinE |
++ More..