Result : EXP02320
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02320 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 37974 |
| Right | 38234 |
| Strand | - |
| Nucleotide Sequence | ATGAATTATGATAAAAAAATGATTAATCGTATTAATAGAATACAAGGGCAACTAAATGGAATTATTAAAATGATGGAGGAAGGAAAAGACTGTAAAGATGTCATTACACAAATAAGTGCATCAAAGAGTTCACTCCAACGCTTGATGGGTATCATTATTAGTGAGAATTTAATAGAATGTGTAAAAGCAGCTGCGGATGATGAAGAAAGCTCCCAAGAGTTAATTAATGAAGCTGTAAACTTATTGGTGAAAAGTAAGTAA |
| Sequence | MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIECVKAAADDEESSQELINEAVNLLVKSK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00846. Profile Description: Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156. This is a family of metal-sensitive repressors, involved in resistance to metal ions. Members of this family bind copper, nickel or cobalt ions via conserved cysteine and histidine residues. In the absence of metal ions, these proteins bind to promoter regions and repress transcription. When bound to metal ions they are unable to bind DNA, leading to transcriptional derepression. |
| Pubmed ID | 34061833 |
| Domain | CDD:412603 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 70
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 37973 | 38233 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2511581 | 2511841 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 3 | 2180867 | 2181127 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 4 | 71372 | 71632 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 5 | 776878 | 777138 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 6 | 824252 | 824512 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 7 | 2569356 | 2569616 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 8 | 92145 | 92405 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 9 | 61654 | 61914 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 10 | 144395 | 144655 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 11 | 888875 | 889135 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 12 | 2210723 | 2210983 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 13 | 284795 | 285055 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 14 | 75355 | 75612 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 15 | 848612 | 848872 | - | NZ_CP027770.1 | Staphylococcus felis |
| 16 | 182568 | 182828 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 17 | 524064 | 524324 | - | NZ_CP047361.1 | Macrococcus canis |
| 18 | 2498867 | 2499130 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 19 | 368740 | 368967 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 20 | 1246047 | 1246307 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 21 | 3537104 | 3537334 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 22 | 368070 | 368300 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 23 | 862360 | 862620 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 24 | 783833 | 784093 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 25 | 2605896 | 2606156 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 26 | 5123269 | 5123532 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 27 | 194783 | 195046 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 28 | 4733711 | 4733971 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 29 | 2530979 | 2531263 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 30 | 2118692 | 2118976 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 31 | 3614972 | 3615232 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 32 | 1811792 | 1812052 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 33 | 424760 | 425020 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 34 | 4120123 | 4120386 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 35 | 2720272 | 2720532 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 36 | 518607 | 518864 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 37 | 3064460 | 3064732 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 38 | 4177054 | 4177317 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 39 | 2582961 | 2583224 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 40 | 682390 | 682650 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 41 | 596927 | 597190 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 42 | 3896415 | 3896672 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 43 | 1206903 | 1207133 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 44 | 50395 | 50658 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 45 | 3643648 | 3643908 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 46 | 3221367 | 3221627 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 47 | 1661020 | 1661283 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 48 | 4587228 | 4587491 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 49 | 377261 | 377521 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 50 | 935396 | 935635 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 51 | 530292 | 530552 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 52 | 2475939 | 2476193 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 53 | 3415069 | 3415329 | - | NZ_CP011937.1 | Bacillus velezensis |
| 54 | 365845 | 366054 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 55 | 4249933 | 4250196 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 56 | 2525471 | 2525731 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 57 | 2713949 | 2714209 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 58 | 45886 | 46146 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 59 | 875818 | 876078 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 60 | 4442097 | 4442360 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 61 | 425697 | 425957 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 62 | 4717254 | 4717514 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 63 | 3699187 | 3699447 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 64 | 1032432 | 1032692 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 65 | 1660719 | 1660979 | + | NZ_CP053989.1 | Niallia circulans |
| 66 | 131792 | 132013 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 67 | 4343210 | 4343470 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 68 | 4541565 | 4541786 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 69 | 400384 | 400644 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 70 | 393066 | 393326 | + | NZ_LS483476.1 | Lederbergia lentus |
| 71 | 2661812 | 2662072 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 72 | 1934166 | 1934429 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 73 | 284478 | 284735 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 74 | 2832766 | 2833026 | - | NZ_CP016538.2 | Planococcus maritimus |
| 75 | 2853733 | 2853993 | - | NZ_CP059540.1 | Planococcus maritimus |
| 76 | 3005565 | 3005825 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 77 | 1424838 | 1425098 | - | NZ_CP014164.1 | Aerococcus viridans |
| 78 | 2683101 | 2683361 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 79 | 2861489 | 2861749 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 80 | 1176118 | 1176327 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 81 | 778632 | 778841 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 82 | 1873136 | 1873378 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 83 | 2781814 | 2782074 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 84 | 2255696 | 2255956 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13686.8 | 0.73 | 51 | 140 | same-strand | DsrE/DsrF/DrsH-like family |
| 2 | PF01206.19 | 0.83 | 58 | 950.5 | same-strand | Sulfurtransferase TusA |
| 3 | PF00581.22 | 0.91 | 64 | 915 | same-strand | Rhodanese-like domain |
| 4 | PF00753.29 | 0.64 | 45 | 1506 | same-strand | Metallo-beta-lactamase superfamily |
++ More..