| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02318 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1473640 |
| Right | 1473891 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATTATATCTATATCAGAAACACCGAACCACAACACAATGAAGATTACACTTAGTGAAAGCAGAGAAGGTATGACATCAGATACGTATACTAAAGTTGATGATTCACAGCCAGCATTTATTAATGACATCTTAAAGGTTGAAGGCGTTAAATCAATTTTCCATGTTATGGACTTTATTTCAGTAGATAAAGAAAATGACGCAAATTGGGAAACAGTATTGCCAAAAGTAGAGGCTGTATTCGAATAA |
| Sequence | MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl07364. Profile Description: Scaffold protein Nfu/NifU N terminal. This domain is found at the N terminus of NifU and NifU related proteins, and in the human Nfu protein. Both of these proteins are thought to be involved in the the assembly of iron-sulphur clusters. |
| Pubmed ID | 34061833 |
| Domain | CDD:415175 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 83 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1373684 | 1373935 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1474839 | 1475090 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1411680 | 1411931 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 24932 | 25186 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 5 | 1402420 | 1402674 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 6 | 757469 | 757723 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 7 | 1507422 | 1507676 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 8 | 1446672 | 1446932 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 9 | 1097460 | 1097711 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 10 | 1920489 | 1920743 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 11 | 402256 | 402510 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 12 | 657266 | 657523 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 13 | 2116270 | 2116518 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 14 | 1328750 | 1329007 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 15 | 1384240 | 1384497 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 16 | 1464796 | 1465053 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 17 | 1514893 | 1515177 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02645.18 | 0.88 | 15 | 3445 | same-strand | Uncharacterised protein, DegV family COG1307 |
| 2 | PF00186.21 | 1.0 | 17 | 2949 | same-strand | Dihydrofolate reductase |
| 3 | PF00303.21 | 1.0 | 17 | 1868 | same-strand | Thymidylate synthase |
| 4 | PF06491.13 | 0.94 | 16 | 1172.0 | same-strand | Disulphide isomerase |
| 5 | PF13769.8 | 0.88 | 15 | 30 | same-strand | Virulence factor |
| 6 | PF08712.13 | 0.76 | 13 | 31 | same-strand | Scaffold protein Nfu/NifU N terminal |
| 7 | PF13646.8 | 0.88 | 15 | 30 | same-strand | HEAT repeats |
| 8 | PF02985.24 | 0.71 | 12 | 30.5 | same-strand | HEAT repeat |
| 9 | PF02592.17 | 0.94 | 16 | 459.5 | opposite-strand | Putative vitamin uptake transporter |
| 10 | PF13456.8 | 0.94 | 16 | 1390.5 | opposite-strand | Reverse transcriptase-like |
| 11 | PF02739.18 | 0.76 | 13 | 17169 | same-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
| 12 | PF01367.22 | 0.76 | 13 | 17169 | same-strand | 5'-3' exonuclease, C-terminal SAM fold |
| 13 | PF00350.25 | 0.65 | 11 | 3513 | same-strand | Dynamin family |
| 14 | PF01926.25 | 0.65 | 11 | 3513 | same-strand | 50S ribosome-binding GTPase |