Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02317 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 2535279 |
Right | 2535530 |
Strand | - |
Nucleotide Sequence | ATGATTATTAAAAATTATTCATACGCTCGACAGAATTTAAAGGCACTTATGACAAAAGTAAATGATGATAGTGATATGGTAACTGTAACATCTACTGATGATAAAAACGTAGTAATCATGTCAGAATCAGATTATAACTCCATGATGGAAACACTTTACCTCCAACAGAACCCAAATAATGCTGAACACTTAGCTCAATCAATTGCAGATCTAGAACGTGGGAAAACTATAACGAAAGATATAGATGTATAA |
Sequence | MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNNAEHLAQSIADLERGKTITKDIDV |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl09153. Profile Description: Antitoxin Phd_YefM, type II toxin-antitoxin system. This model recognizes a region of about 55 amino acids toward the N-terminal end of bacterial proteins of about 85 amino acids in length. The best-characterized member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (TIGR01550) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other] |
Pubmed ID | 34061833 |
Domain | CDD:415595 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 83 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2477447 | 2477698 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 2438956 | 2439207 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 51708 | 51962 | + | NZ_LR134242.1 | Staphylococcus warneri |
4 | 1433109 | 1433363 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
5 | 277017 | 277271 | + | NZ_LT906460.1 | Staphylococcus simiae |
6 | 331258 | 331515 | - | NZ_AP018587.1 | Staphylococcus caprae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06769.16 | 1.0 | 6 | -7.0 | same-strand | YoeB-like toxin of bacterial type II toxin-antitoxin system |
2 | PF15738.7 | 0.67 | 4 | -3.5 | same-strand | Bacterial toxin of type II toxin-antitoxin system, YafQ |