Result : EXP02316

Protein Information

• Protein name: EXP02316
• NCBI Accession ID: NC_009641.1
• Organism: Staphylococcus aureus subsp. aureus str. Newman
• Left: 2117272
• Right: 2117523
• Strand: -
• Nucleotide Sequence: ATGAATAATCGCGAACAAATTGAACAATCAGTTATAAGTGCTAGTGCGTATAACGGTAATGACACAGAGGGATTACTAAAAGAGATTGAGGACGTTTATAAGAAAGCGCAAGCGTTTGATGAAATACTTGAGGGAATGACAAATGCTATTCAACATTCAGTTAAAGAAGGTGTTGAACTTGATGAAGCAGTAGGGATTATGGCAGGTCAAGTTGTCTATAAATATGAGGAGGAACAGGAAAATGAGCATTAG
• Sequence: MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQENEH
• Source of smORF: Protein-level
• Function: The ORF matches to the profile of pfam06260. Profile Description: Protein of unknown function (DUF1024). This family consists of several hypothetical Staphylococcus aureus and Staphylococcus aureus phage phi proteins. The function of this family is unknown.
• Pubmed ID: 34061833
• Domain: CDD:283838
• Functional Category: Conserved domain based functional assignment
• ORF Length (Amino Acid): 83

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1952825	1953070	-	NC_007795.1	Staphylococcus aureus subsp. aureus NCTC 8325
2	2060564	2060818	-	NC_007795.1	Staphylococcus aureus subsp. aureus NCTC 8325
3	828977	829219	+	NZ_LR134304.1	Staphylococcus schweitzeri

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_007795.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07129.13	1.0	2	913	same-strand	Protein of unknown function (DUF1381)
2	PF08761.13	1.0	2	75.0	same-strand	dUTPase