| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02316 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2117272 |
| Right | 2117523 |
| Strand | - |
| Nucleotide Sequence | ATGAATAATCGCGAACAAATTGAACAATCAGTTATAAGTGCTAGTGCGTATAACGGTAATGACACAGAGGGATTACTAAAAGAGATTGAGGACGTTTATAAGAAAGCGCAAGCGTTTGATGAAATACTTGAGGGAATGACAAATGCTATTCAACATTCAGTTAAAGAAGGTGTTGAACTTGATGAAGCAGTAGGGATTATGGCAGGTCAAGTTGTCTATAAATATGAGGAGGAACAGGAAAATGAGCATTAG |
| Sequence | MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQENEH |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam06260. Profile Description: Protein of unknown function (DUF1024). This family consists of several hypothetical Staphylococcus aureus and Staphylococcus aureus phage phi proteins. The function of this family is unknown. |
| Pubmed ID | 34061833 |
| Domain | CDD:283838 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 83 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1952825 | 1953070 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2060564 | 2060818 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 828977 | 829219 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07129.13 | 1.0 | 2 | 913 | same-strand | Protein of unknown function (DUF1381) |
| 2 | PF08761.13 | 1.0 | 2 | 75.0 | same-strand | dUTPase |