Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02315 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 2324400 |
Right | 2324639 |
Strand | - |
Nucleotide Sequence | ATGGCTAACAATCATAACCAAAACGGACAAGACTCTACACAACAAGTGATTAATTTTTTAAAAGTATTTAAATGGAGAATCGTTGGTTTCCTAGCGTTTCTATTAATCGCGATATTATTCTTAACGTTAGGTTTTTGGAAAACAGTACTTATCATCGTTTTATGTTTAATTGGTGTAGGTATTGGGTATATGAAAGACCGTAAGCAAGATTTTATGAATTTTTTAAATCGATGGAGTTAA |
Sequence | MANNHNQNGQDSTQQVINFLKVFKWRIVGFLAFLLIAILFLTLGFWKTVLIIVLCLIGVGIGYMKDRKQDFMNFLNRWS |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl26571. Profile Description: Small integral membrane protein (DUF2273). Members of this family of hypothetical bacterial proteins have no known function. |
Pubmed ID | 34061833 |
Domain | CDD:421344 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2266669 | 2266908 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 2215029 | 2215268 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 741759 | 741998 | + | NZ_LR134242.1 | Staphylococcus warneri |
4 | 686913 | 687152 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
5 | 818426 | 818665 | + | NZ_AP018587.1 | Staphylococcus caprae |
6 | 1404988 | 1405227 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
7 | 2712304 | 2712543 | + | NZ_CP018199.1 | Staphylococcus succinus |
8 | 790755 | 790994 | + | NZ_CP064056.1 | Staphylococcus lloydii |
9 | 813837 | 814076 | + | NZ_CP008724.1 | Staphylococcus xylosus |
10 | 757434 | 757673 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
11 | 787759 | 787998 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
12 | 1955180 | 1955419 | - | NZ_CP013114.1 | Staphylococcus equorum |
13 | 1751431 | 1751670 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
14 | 2294534 | 2294773 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
15 | 1539931 | 1540167 | + | NZ_CP033732.1 | Staphylococcus hominis |
16 | 930591 | 930827 | + | NZ_CP018776.1 | Staphylococcus condimenti |
17 | 2157445 | 2157681 | - | NZ_CP033460.1 | Staphylococcus debuckii |
18 | 2134664 | 2134903 | - | NZ_LT906460.1 | Staphylococcus simiae |
19 | 1029762 | 1030001 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
20 | 178565 | 178804 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
21 | 633498 | 633692 | + | NZ_CP065712.1 | Staphylococcus auricularis |
22 | 585391 | 585594 | - | NZ_CP020773.1 | Staphylococcus lutrae |
23 | 1694690 | 1694935 | - | NZ_LT906464.1 | Staphylococcus muscae |
24 | 1859679 | 1859903 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
25 | 288768 | 288992 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
26 | 368586 | 368810 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
27 | 1150451 | 1150693 | + | NZ_CP008747.1 | Staphylococcus hyicus |
28 | 1403816 | 1404058 | - | NZ_CP045927.1 | Staphylococcus agnetis |
29 | 1932025 | 1932270 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
30 | 165176 | 165418 | - | NZ_CP027770.1 | Staphylococcus felis |
31 | 123282 | 123524 | - | NZ_CP027770.1 | Staphylococcus felis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04183.14 | 0.77 | 23 | 2413.0 | both-strands | IucA / IucC family |
2 | PF06276.14 | 0.77 | 23 | 2413.0 | both-strands | Ferric iron reductase FhuF-like transporter |
3 | PF03780.15 | 1.0 | 30 | 65 | same-strand | Asp23 family, cell envelope-related function |
4 | PF00107.28 | 0.77 | 23 | 2527.5 | same-strand | Zinc-binding dehydrogenase |
5 | PF13602.8 | 0.8 | 24 | 2519 | same-strand | Zinc-binding dehydrogenase |
6 | PF16884.7 | 0.67 | 20 | 3525.0 | same-strand | N-terminal domain of oxidoreductase |
7 | PF01168.22 | 0.67 | 20 | 5674.5 | same-strand | Alanine racemase, N-terminal domain |
8 | PF07690.18 | 0.6 | 18 | 2750.5 | same-strand | Major Facilitator Superfamily |