Result : EXP02314
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02314 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 860990 |
| Right | 861226 |
| Strand | - |
| Nucleotide Sequence | ATGGATAATCATAATCAATGTAATTATGTGAATCCACAAAATGTTTCACTTGACTGGGAATGTTTTATAATTAGTAAAAGTGAAATGTTGTTAGATGGTGTACCAAATGAACTTATCAACACTTGGTTAGATAAAGACATTATTACACCATTTTCGATAAGAAATGATGAAATAAACTTTAAAACAAAAGATATTTGGGATGCACTAATACATCATAATTGGTACTACTCAAATTAA |
| Sequence | MDNHNQCNYVNPQNVSLDWECFIISKSEMLLDGVPNELINTWLDKDIITPFSIRNDEINFKTKDIWDALIHHNWYYSN |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 804200 | 804436 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 873764 | 874000 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2119919 | 2120155 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 4 | 164542 | 164778 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 1392099 | 1392335 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 6 | 822550 | 822786 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 7 | 1939025 | 1939258 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 8 | 1991801 | 1992037 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 9 | 432958 | 433200 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 10 | 1911757 | 1911990 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 11 | 2024708 | 2024941 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 12 | 574262 | 574504 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 13 | 1947146 | 1947382 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 14 | 2041972 | 2042208 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 15 | 1257578 | 1257814 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 16 | 691441 | 691677 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 17 | 922644 | 922886 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 18 | 1803395 | 1803631 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 19 | 2365066 | 2365296 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06855.14 | 0.89 | 17 | -3 | opposite-strand | YozE SAM-like fold |
| 2 | PF00300.24 | 0.63 | 12 | 224.5 | opposite-strand | Histidine phosphatase superfamily (branch 1) |
| 3 | PF13420.9 | 1.0 | 19 | 1656 | same-strand | Acetyltransferase (GNAT) domain |
| 4 | PF02566.21 | 0.89 | 17 | 2544 | same-strand | OsmC-like protein |
| 5 | PF01487.17 | 0.84 | 16 | 3112.5 | opposite-strand | Type I 3-dehydroquinase |
++ More..