Result : EXP02313
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02313 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1175555 |
| Right | 1175788 |
| Strand | - |
| Nucleotide Sequence | ATGGTTTTTAATGATTGGGAAATTAACGTTGTATACTCAGGAGAGCATGAGGTTGTAACAAACGAAAAGAGTTTATTTGTCATTGACGAATTTTACGATGTTGCAATCGCAATCTATTATTTAGATGGAAAATTAAAAGTAGCTCATGTCAACTATGGTTCTGATTTTACAATTGACGTAGCTAATAAAGTTTTTGAATTGAATATTCAAAATCCAAATGTTGATGAGCATTAA |
| Sequence | MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDVANKVFELNIQNPNVDEH |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1075703 | 1075936 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1146539 | 1146772 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 840409 | 840654 | - | NZ_CP027770.1 | Staphylococcus felis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16104.7 | 0.67 | 2 | 3857.0 | same-strand | Formyl peptide receptor-like 1 inhibitory protein |
| 2 | PF12199.10 | 0.67 | 2 | 1839.5 | opposite-strand | Extracellular fibrinogen binding protein C terminal |
| 3 | PF11546.10 | 0.67 | 2 | 1335.5 | opposite-strand | Staphylococcal complement inhibitor SCIN |
| 4 | PF07968.14 | 0.67 | 2 | 474.5 | same-strand | Leukocidin/Hemolysin toxin family |
++ More..