Result : EXP02312
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02312 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1057056 |
| Right | 1057289 |
| Strand | - |
| Nucleotide Sequence | ATGTCAGAAATAATCGTTTATACGCAGAATGATTGTCCACCTTGTACATTTGTAAAAAATTATCTAAATGAGCATCACATTGATTTTGAAGAGAGAAATATCAACAATCAACAATATCGAAACGAAATGATAGATTTTGATGCTTTTTCAACTCCGTTTATTTTGTTGAATGGCAATCCAATGTACCATGTTGATCTTGATGAAATCAACAAAGTATTAAATATCCAAGATTAA |
| Sequence | MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNPMYHVDLDEINKVLNIQD |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
| Pubmed ID | 34061833 |
| Domain | CDD:412351 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1000346 | 1000579 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1070672 | 1070905 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1048967 | 1049200 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 54695 | 54925 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 5 | 1927045 | 1927281 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 6 | 834929 | 835162 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 7 | 1764310 | 1764540 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 8 | 1855996 | 1856226 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 9 | 1554912 | 1555145 | - | NZ_CP027770.1 | Staphylococcus felis |
| 10 | 887305 | 887535 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 11 | 1072561 | 1072791 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 12 | 391730 | 391972 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 13 | 1131492 | 1131728 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 14 | 755777 | 756010 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 15 | 231367 | 231600 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 16 | 1595626 | 1595868 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 17 | 706973 | 707200 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 18 | 1768871 | 1769104 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 19 | 1736883 | 1737113 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 20 | 683544 | 683771 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 21 | 1932458 | 1932691 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 22 | 1830657 | 1830884 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 23 | 2243859 | 2244089 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 24 | 692567 | 692800 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 25 | 2043803 | 2044033 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 26 | 1804871 | 1805095 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 27 | 1574134 | 1574364 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 28 | 1616374 | 1616604 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 29 | 1704564 | 1704797 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 30 | 540139 | 540372 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 31 | 523715 | 523957 | - | NZ_CP019573.1 | Abyssicoccus albus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17785.3 | 0.84 | 26 | 2955.5 | opposite-strand | PUA-like domain |
| 2 | PF00381.21 | 0.97 | 30 | 1946.0 | opposite-strand | PTS HPr component phosphorylation site |
| 3 | PF02896.20 | 0.97 | 30 | 225.0 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
| 4 | PF05524.15 | 0.97 | 30 | 225.0 | opposite-strand | PEP-utilising enzyme, N-terminal |
| 5 | PF00391.25 | 0.97 | 30 | 225.0 | opposite-strand | PEP-utilising enzyme, mobile domain |
| 6 | PF01654.19 | 0.87 | 27 | 202 | opposite-strand | Cytochrome bd terminal oxidase subunit I |
| 7 | PF02322.17 | 0.9 | 28 | 1553.0 | opposite-strand | Cytochrome bd terminal oxidase subunit II |
| 8 | PF02254.20 | 1.0 | 31 | 2670 | opposite-strand | TrkA-N domain |
| 9 | PF02080.23 | 1.0 | 31 | 2670 | opposite-strand | TrkA-C domain |
| 10 | PF17770.3 | 0.94 | 29 | 3497 | same-strand | Ribonuclease J C-terminal domain |
| 11 | PF07288.13 | 0.71 | 22 | 5170.0 | same-strand | RNA polymerase epsilon subunit |
++ More..