Result : EXP02311
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02311 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1864751 |
| Right | 1864975 |
| Strand | - |
| Nucleotide Sequence | ATGGATTACGCACATTTAAATTTAGAACATTTTTTTGCACGAAACGACGATTTAGATGTTATAAGAGATCGCGCTGATTTCGTGATGATAAATAACTTCACTAATGAAATGATGTATCGTGATGGTCAAATTGAAGGCACGATTGATTTAAATCAGTACTATTATAAAAATAGATCAAATGCAGCAAGTTTTATTATGATGGATTATAAAAAAGAAACTAAGTAA |
| Sequence | MDYAHLNLEHFFARNDDLDVIRDRADFVMINNFTNEMMYRDGQIEGTIDLNQYYYKNRSNAASFIMMDYKKETK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1807912 | 1808136 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1869150 | 1869374 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1792420 | 1792650 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1116799 | 1117017 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 1134371 | 1134589 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 6 | 1462127 | 1462348 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 7 | 22142 | 22366 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 8 | 2249614 | 2249832 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 9 | 1802446 | 1802670 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 10 | 390685 | 390909 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 11 | 1082658 | 1082873 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 12 | 1039367 | 1039591 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 13 | 1165348 | 1165572 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 14 | 1389047 | 1389271 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 15 | 1597938 | 1598162 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 16 | 1249173 | 1249394 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 17 | 1847642 | 1847863 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 18 | 1051173 | 1051397 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 19 | 276228 | 276452 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 20 | 1127791 | 1128015 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 21 | 1101958 | 1102182 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 22 | 244122 | 244343 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 23 | 1663617 | 1663841 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 24 | 2224760 | 2224984 | - | NZ_CP027770.1 | Staphylococcus felis |
| 25 | 722731 | 722955 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 26 | 942797 | 943021 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 27 | 1388858 | 1389079 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 28 | 918135 | 918356 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 29 | 838670 | 838891 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 30 | 1321122 | 1321343 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906460.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13454.8 | 0.9 | 27 | 1481 | same-strand | FAD-NAD(P)-binding |
| 2 | PF01832.22 | 1.0 | 30 | 202.0 | same-strand | Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase |
| 3 | PF04542.16 | 0.9 | 27 | 203 | opposite-strand | Sigma-70 region 2 |
| 4 | PF00923.21 | 0.9 | 27 | 1765 | same-strand | Transaldolase/Fructose-6-phosphate aldolase |
| 5 | PF01872.19 | 0.87 | 26 | 3457.5 | same-strand | RibD C-terminal domain |
| 6 | PF00383.25 | 0.87 | 26 | 3457.5 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 7 | PF00926.21 | 0.6 | 18 | 5115.5 | same-strand | 3,4-dihydroxy-2-butanone 4-phosphate synthase |
| 8 | PF00925.22 | 0.6 | 18 | 5115.5 | same-strand | GTP cyclohydrolase II |
| 9 | PF00677.19 | 0.8 | 24 | 4489.0 | same-strand | Lumazine binding domain |
++ More..