Result : EXP02310
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02310 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2159825 |
| Right | 2160049 |
| Strand | - |
| Nucleotide Sequence | ATGATACACGAATTAGGTACAGTAGGAATGGTATGTCCATTTCCGTTAATTGAAGCGCAAAAGAAAATGGCAACATTGCAATCTGGAGATGAATTAAAAATTGATTTTGATTGCACGCAAGCGACGGAAGCCATTCCAAATTGGGCTGCAGAAAATGGTTATCCTGTAACAAACTATGAACAAATTGATAATGCTTCATGGACAATTACAATTCAAAAAGTTTAA |
| Sequence | MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPVTNYEQIDNASWTITIQKV |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00436. Profile Description: N/A. Members of this family of hypothetical bacterial proteins have no known function. |
| Pubmed ID | 34061833 |
| Domain | CDD:412376 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | P33014 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 130
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2102179 | 2102403 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2056543 | 2056767 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 875371 | 875595 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 4 | 1264578 | 1264802 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 956692 | 956916 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 6 | 931340 | 931564 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 7 | 548546 | 548770 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 8 | 959214 | 959438 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 9 | 1665864 | 1666088 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 10 | 2433533 | 2433757 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 11 | 1612241 | 1612465 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 12 | 1252143 | 1252367 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 13 | 901259 | 901483 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 14 | 517518 | 517742 | + | NZ_CP047361.1 | Macrococcus canis |
| 15 | 921987 | 922211 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 16 | 880744 | 880968 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 17 | 1074448 | 1074672 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 18 | 113440 | 113667 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 19 | 1810929 | 1811156 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 20 | 1975711 | 1975935 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 21 | 1602351 | 1602578 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 22 | 871966 | 872190 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 23 | 2011924 | 2012148 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 24 | 628137 | 628361 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 25 | 712611 | 712835 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 26 | 1520544 | 1520768 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 27 | 2455231 | 2455455 | - | NZ_CP027770.1 | Staphylococcus felis |
| 28 | 1554182 | 1554406 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 29 | 3812070 | 3812294 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 30 | 970514 | 970711 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 31 | 754452 | 754676 | + | NZ_CP026734.1 | Brevibacterium linens |
| 32 | 45242 | 45436 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 33 | 1588693 | 1588917 | + | NZ_CP065682.1 | Brevibacterium casei |
| 34 | 696871 | 697095 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 35 | 2194264 | 2194458 | + | NZ_CP034438.1 | Flaviflexus salsibiostraticola |
| 36 | 510610 | 510804 | - | NZ_LT906441.1 | Cutibacterium granulosum |
| 37 | 1632983 | 1633204 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 38 | 538435 | 538659 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 39 | 2124987 | 2125211 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 40 | 772788 | 773009 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 41 | 1949438 | 1949662 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 42 | 3728852 | 3729079 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 43 | 2844123 | 2844350 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 44 | 1224314 | 1224535 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 45 | 1318421 | 1318645 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 46 | 920207 | 920428 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 47 | 2954691 | 2954915 | + | NZ_CP035810.1 | Brevibacterium luteolum |
| 48 | 1343467 | 1343691 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 49 | 205084 | 205278 | + | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
| 50 | 1374067 | 1374261 | - | NC_021064.1 | Cutibacterium avidum 44067 |
| 51 | 1572819 | 1573022 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 52 | 392958 | 393185 | - | NZ_CP013254.1 | Kocuria flava |
| 53 | 684753 | 684968 | + | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 54 | 4344696 | 4344902 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 55 | 2500154 | 2500360 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 56 | 315961 | 316185 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 57 | 1764269 | 1764496 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 58 | 1685912 | 1686112 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 59 | 1426048 | 1426242 | + | NZ_CP038256.1 | Microbacterium sediminis |
| 60 | 816129 | 816353 | + | NZ_CP025333.1 | Brevibacterium aurantiacum |
| 61 | 2335874 | 2336077 | - | NZ_LR134201.1 | Cedecea lapagei |
| 62 | 2084226 | 2084450 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 63 | 1071778 | 1071981 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 64 | 2089795 | 2089998 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 65 | 2756869 | 2757072 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 66 | 1337546 | 1337776 | - | NZ_LN849456.1 | Devriesea agamarum |
| 67 | 2523712 | 2523936 | - | NZ_CP033325.1 | Georgenia faecalis |
| 68 | 1794736 | 1794957 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 69 | 298396 | 298617 | - | NZ_LR134167.1 | Avibacterium volantium |
| 70 | 1770224 | 1770430 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 71 | 1874999 | 1875211 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 72 | 15468 | 15674 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 73 | 3052198 | 3052404 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 74 | 2246835 | 2247038 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 75 | 838137 | 838361 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 76 | 3310355 | 3310582 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 77 | 1273065 | 1273289 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 78 | 175327 | 175524 | - | NZ_LS483464.1 | Corynebacterium renale |
| 79 | 3694755 | 3694958 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 80 | 1371116 | 1371337 | + | NZ_CP066060.1 | Actinomyces oris |
| 81 | 729749 | 729970 | + | NZ_CP061280.1 | Mannheimia bovis |
| 82 | 449237 | 449461 | + | NZ_CP061280.1 | Mannheimia bovis |
| 83 | 1886186 | 1886407 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 84 | 1013043 | 1013264 | + | NZ_LR134477.1 | Actinomyces viscosus |
| 85 | 2671908 | 2672129 | + | NZ_CP014228.1 | Actinomyces radicidentis |
| 86 | 1919297 | 1919491 | - | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 87 | 1328029 | 1328250 | - | NZ_CP025227.1 | Actinomyces wuliandei |
| 88 | 2382210 | 2382431 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 89 | 1574518 | 1574700 | - | NZ_CP068168.1 | Corynebacterium amycolatum |
| 90 | 2016821 | 2017072 | - | NZ_CP011545.1 | Corynebacterium testudinoris |
| 91 | 1894981 | 1895190 | - | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 92 | 560211 | 560402 | + | NZ_LR134350.1 | Actinomyces howellii |
| 93 | 516603 | 516827 | - | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 94 | 641538 | 641765 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 95 | 1000762 | 1000986 | + | NZ_CP040635.1 | Acidipropionibacterium jensenii |
| 96 | 2742669 | 2742863 | - | NZ_CP035504.1 | Kocuria indica |
| 97 | 2432347 | 2432574 | + | NC_012803.1 | Micrococcus luteus NCTC 2665 |
| 98 | 425519 | 425746 | - | NZ_CP032788.1 | Corynebacterium xerosis |
| 99 | 2412944 | 2413165 | + | NZ_CP066049.1 | Actinomyces naeslundii |
| 100 | 1455008 | 1455217 | - | NZ_CP039292.1 | Actinomyces procaprae |
| 101 | 1997042 | 1997290 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 102 | 1786643 | 1786906 | - | NZ_LR738855.1 | Corynebacterium rouxii |
| 103 | 187278 | 187541 | + | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 104 | 1724693 | 1724899 | - | NZ_CP011546.1 | Corynebacterium uterequi |
| 105 | 741398 | 741622 | + | NZ_CP046378.1 | Shewanella algae |
| 106 | 1216935 | 1217156 | + | NZ_CP020468.1 | Actinomyces gaoshouyii |
| 107 | 2085786 | 2086007 | - | NZ_LR134363.1 | Actinomyces slackii |
| 108 | 185141 | 185335 | + | NZ_CP046883.1 | Corynebacterium anserum |
| 109 | 3299311 | 3299541 | - | NZ_CP023564.1 | Brachybacterium ginsengisoli |
| 110 | 3625752 | 3625982 | + | NZ_CP031356.1 | Brachybacterium saurashtrense |
| 111 | 1120949 | 1121170 | - | NZ_CP053642.1 | Actinomyces marmotae |
| 112 | 178036 | 178239 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 113 | 1529295 | 1529510 | + | NZ_CP009248.1 | Corynebacterium sphenisci DSM 44792 |
| 114 | 2154096 | 2154302 | - | NC_021915.1 | Corynebacterium maris DSM 45190 |
| 115 | 3782878 | 3783105 | + | NZ_LR134531.1 | Pragia fontium |
| 116 | 1757273 | 1757473 | - | NZ_CP008944.1 | Corynebacterium atypicum |
| 117 | 299956 | 300150 | + | NZ_CP039247.1 | Corynebacterium endometrii |
| 118 | 1832608 | 1832835 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 119 | 2435072 | 2435287 | + | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 120 | 2318468 | 2318698 | + | NZ_CP022316.1 | Brachybacterium avium |
| 121 | 1450232 | 1450432 | + | NZ_CP011542.1 | Corynebacterium mustelae |
| 122 | 2046222 | 2046449 | + | NZ_CP061538.1 | Rothia amarae |
| 123 | 2002518 | 2002709 | - | NZ_CP009247.1 | Corynebacterium frankenforstense DSM 45800 |
| 124 | 769668 | 769850 | + | NZ_CP067012.1 | Corynebacterium kefirresidentii |
| 125 | 805215 | 805427 | - | NZ_LT906443.1 | Corynebacterium ulcerans |
| 126 | 1706082 | 1706294 | - | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 127 | 540925 | 541155 | + | NC_013172.1 | Brachybacterium faecium DSM 4810 |
| 128 | 75845 | 76075 | - | NZ_CP023563.1 | Brachybacterium vulturis |
| 129 | 2009379 | 2009606 | + | NZ_CP011254.1 | Serratia fonticola |
| 130 | 3241513 | 3241710 | - | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 131 | 2154933 | 2155130 | + | NZ_CP061539.1 | Rothia terrae |
| 132 | 1119329 | 1119556 | + | NZ_CP007519.1 | Trueperella pyogenes |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04143.16 | 0.78 | 101 | 25 | same-strand | Sulphur transport |
++ More..