| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02309 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1467339 |
| Right | 1467560 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAACTATTCGTTTTATCAATTTGTCATGACAGTTCGTGGTCGACACGACGATAAAGGTCGTCTAGCAGAAGAGATATTTGACGATCTTGCTTTCCCAAAACACGATGATGATTTTAACATACTGTCTGATTATATTGAGACACATGGTGATTTCACATTGCCAATGTCTGTATTTGATGATTTATATGAAGAATATACGGAATGGCTAAAATTTTAA |
| Sequence | MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKF |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 34061833 |
| Domain | CDD:416295 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | Q5HPB6 |
| ORF Length (Amino Acid) | 73 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1367383 | 1367604 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1468539 | 1468760 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1408563 | 1408784 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 4 | 18819 | 19040 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 5 | 1513425 | 1513616 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 6 | 751494 | 751685 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 7 | 1405457 | 1405678 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 8 | 1453619 | 1453804 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 9 | 1433091 | 1433312 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 10 | 1914642 | 1914833 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 11 | 2122200 | 2122421 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 12 | 663317 | 663538 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 13 | 1390375 | 1390596 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 14 | 1532552 | 1532773 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 15 | 396814 | 397035 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 16 | 1205814 | 1206035 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 17 | 1470978 | 1471199 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 18 | 379445 | 379666 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 19 | 1091451 | 1091672 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 20 | 1563677 | 1563898 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 21 | 1884886 | 1885107 | - | NZ_CP027770.1 | Staphylococcus felis |
| 22 | 1322640 | 1322861 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 23 | 2421912 | 2422133 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 24 | 1228817 | 1229038 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 25 | 1272716 | 1272937 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 26 | 1497169 | 1497390 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 27 | 1306679 | 1306900 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 28 | 1059614 | 1059835 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 29 | 1221703 | 1221924 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 30 | 942027 | 942248 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 31 | 1210514 | 1210735 | - | NZ_CP047361.1 | Macrococcus canis |
| 32 | 504263 | 504484 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 33 | 2358165 | 2358359 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01569.23 | 0.97 | 32 | 3258.0 | same-strand | PAP2 superfamily |
| 2 | PF03033.22 | 0.97 | 32 | 2169.0 | same-strand | Glycosyltransferase family 28 N-terminal domain |
| 3 | PF04101.18 | 0.97 | 32 | 2169.0 | same-strand | Glycosyltransferase family 28 C-terminal domain |
| 4 | PF00583.27 | 0.88 | 29 | 1655 | same-strand | Acetyltransferase (GNAT) family |
| 5 | PF13420.9 | 0.76 | 25 | 1688 | same-strand | Acetyltransferase (GNAT) domain |
| 6 | PF03572.20 | 0.97 | 32 | 169.0 | same-strand | Peptidase family S41 |
| 7 | PF17820.3 | 0.97 | 32 | 169.0 | same-strand | PDZ domain |
| 8 | PF13180.8 | 0.97 | 32 | 169.0 | same-strand | PDZ domain |
| 9 | PF00595.26 | 0.97 | 32 | 169.0 | same-strand | PDZ domain |
| 10 | PF01471.20 | 0.97 | 32 | 169.0 | same-strand | Putative peptidoglycan binding domain |
| 11 | PF00358.22 | 0.97 | 32 | 0.0 | same-strand | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
| 12 | PF01641.20 | 1.0 | 33 | 515 | same-strand | SelR domain |
| 13 | PF01625.23 | 1.0 | 33 | 936 | same-strand | Peptide methionine sulfoxide reductase |
| 14 | PF02645.18 | 0.97 | 32 | 1564.5 | same-strand | Uncharacterised protein, DegV family COG1307 |
| 15 | PF00186.21 | 0.85 | 28 | 2413.0 | same-strand | Dihydrofolate reductase |
| 16 | PF00072.26 | 0.79 | 26 | 4334.5 | same-strand | Response regulator receiver domain |
| 17 | PF00486.30 | 0.79 | 26 | 4334.5 | same-strand | Transcriptional regulatory protein, C terminal |