Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02308 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 2754920 |
Right | 2755132 |
Strand | - |
Nucleotide Sequence | ATGAGCTTTTACGAATATATACAAACATTTAAAGATGATAAAACACCATTAGGCGAATTAGCGATTTGGATTAAAGAAGATGATTCATTCCCAAAACAAGAGAAGCTAACAGAAAACATTTTGTCTTATTTTCATCAAATGTCCAATATAGATCATGAGTTTTTAGAAATTGTAAAAAGATCACTTTCTCTGTATGATCAATTAAAATCGTAA |
Sequence | MSFYEYIQTFKDDKTPLGELAIWIKEDDSFPKQEKLTENILSYFHQMSNIDHEFLEIVKRSLSLYDQLKS |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
Pubmed ID | 34061833 |
Domain | CDD:416295 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2697435 | 2697647 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 2658816 | 2659028 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 2524588 | 2524797 | - | NZ_LT906460.1 | Staphylococcus simiae |
4 | 1174175 | 1174384 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
5 | 1171335 | 1171541 | + | NZ_CP033732.1 | Staphylococcus hominis |
6 | 2149827 | 2150039 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
7 | 300947 | 301156 | + | NZ_LR134242.1 | Staphylococcus warneri |
8 | 398193 | 398405 | + | NZ_AP018587.1 | Staphylococcus caprae |
9 | 1816159 | 1816371 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
10 | 554197 | 554409 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
11 | 408720 | 408938 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
12 | 1466750 | 1466965 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06039.17 | 0.67 | 8 | 6224.0 | same-strand | Malate:quinone oxidoreductase (Mqo) |
2 | PF00501.30 | 0.83 | 10 | 761.5 | same-strand | AMP-binding enzyme |
3 | PF13193.8 | 0.92 | 11 | 811 | same-strand | AMP-binding enzyme C-terminal domain |
4 | PF03992.18 | 0.92 | 11 | 36 | same-strand | Antibiotic biosynthesis monooxygenase |
5 | PF00732.21 | 0.75 | 9 | 1944 | same-strand | GMC oxidoreductase |
6 | PF05199.15 | 0.75 | 9 | 1944 | same-strand | GMC oxidoreductase |
7 | PF00171.24 | 0.75 | 9 | 3822 | same-strand | Aldehyde dehydrogenase family |
8 | PF02896.20 | 0.67 | 8 | 2575.0 | same-strand | PEP-utilising enzyme, PEP-binding domain |
9 | PF00391.25 | 0.67 | 8 | 2575.0 | same-strand | PEP-utilising enzyme, mobile domain |