Result : EXP02308
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02308 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2754920 |
| Right | 2755132 |
| Strand | - |
| Nucleotide Sequence | ATGAGCTTTTACGAATATATACAAACATTTAAAGATGATAAAACACCATTAGGCGAATTAGCGATTTGGATTAAAGAAGATGATTCATTCCCAAAACAAGAGAAGCTAACAGAAAACATTTTGTCTTATTTTCATCAAATGTCCAATATAGATCATGAGTTTTTAGAAATTGTAAAAAGATCACTTTCTCTGTATGATCAATTAAAATCGTAA |
| Sequence | MSFYEYIQTFKDDKTPLGELAIWIKEDDSFPKQEKLTENILSYFHQMSNIDHEFLEIVKRSLSLYDQLKS |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 34061833 |
| Domain | CDD:416295 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2697435 | 2697647 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2658816 | 2659028 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2524588 | 2524797 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1174175 | 1174384 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 5 | 1171335 | 1171541 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 6 | 2149827 | 2150039 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 7 | 300947 | 301156 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 8 | 398193 | 398405 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 9 | 1816159 | 1816371 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 10 | 554197 | 554409 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 11 | 408720 | 408938 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 12 | 1466750 | 1466965 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022737.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06039.17 | 0.67 | 8 | 6224.0 | same-strand | Malate:quinone oxidoreductase (Mqo) |
| 2 | PF00501.30 | 0.83 | 10 | 761.5 | same-strand | AMP-binding enzyme |
| 3 | PF13193.8 | 0.92 | 11 | 811 | same-strand | AMP-binding enzyme C-terminal domain |
| 4 | PF03992.18 | 0.92 | 11 | 36 | same-strand | Antibiotic biosynthesis monooxygenase |
| 5 | PF00732.21 | 0.75 | 9 | 1944 | same-strand | GMC oxidoreductase |
| 6 | PF05199.15 | 0.75 | 9 | 1944 | same-strand | GMC oxidoreductase |
| 7 | PF00171.24 | 0.75 | 9 | 3822 | same-strand | Aldehyde dehydrogenase family |
| 8 | PF02896.20 | 0.67 | 8 | 2575.0 | same-strand | PEP-utilising enzyme, PEP-binding domain |
| 9 | PF00391.25 | 0.67 | 8 | 2575.0 | same-strand | PEP-utilising enzyme, mobile domain |
++ More..