Result : EXP02306
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02306 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 140399 |
| Right | 140602 |
| Strand | - |
| Nucleotide Sequence | ATGGATAAAGAATCTGTCGTAGCAAGTTTAGCTAGAAACAAAAAGATTGCTGTAGAAACAATGGCCGGTCAAAGGTACATCATAGAACGCATTTTACATACAAATGATGAAAAACATATTCATATTTTGAAACCTAAAGATGTCGTGTTAGATGTAGATAGCATCAAAGAAATTGACGAAAATCATTTAAATGATGCAACATAA |
| Sequence | MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKPKDVVLDVDSIKEIDENHLNDAT |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 140422 | 140625 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 141424 | 141627 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 136542 | 136745 | - | NZ_LT906460.1 | Staphylococcus simiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02350.21 | 0.67 | 2 | 4374.5 | opposite-strand | UDP-N-acetylglucosamine 2-epimerase |
| 2 | PF03992.18 | 0.67 | 2 | 3911.5 | same-strand | Antibiotic biosynthesis monooxygenase |
| 3 | PF04304.15 | 1.0 | 3 | 3462 | same-strand | Protein of unknown function (DUF454) |
| 4 | PF00171.24 | 1.0 | 3 | 1609.0 | opposite-strand | Aldehyde dehydrogenase family |
| 5 | PF01545.23 | 0.67 | 2 | 60.0 | opposite-strand | Cation efflux family |
| 6 | PF14026.8 | 1.0 | 3 | 179 | opposite-strand | Protein of unknown function (DUF4242) |
| 7 | PF00005.29 | 1.0 | 3 | 1033 | opposite-strand | ABC transporter |
| 8 | PF13379.8 | 1.0 | 3 | 1789 | opposite-strand | NMT1-like family |
| 9 | PF00528.24 | 1.0 | 3 | 2758 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
++ More..