Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02305 |
NCBI Accession ID | NC_009641.1 |
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Left | 1619073 |
Right | 1619276 |
Strand | - |
Nucleotide Sequence | ATGAGTCGAAAAATAAATAACTTTTATGATGTACAACAGTTATTGAAAAGTTACGGATTTCTAATATATTTTAAAAATCCAGAAGATATGTACGAAATGATTCAACAGGAGATTTCATCATTGTATCAATATGAACTGTTATCTAAGGAAGAATATTTGAAATGTACGTTGATAATTAATCAGAGAAGGAATGAACAGAAATGA |
Sequence | MSRKINNFYDVQQLLKSYGFLIYFKNPEDMYEMIQQEISSLYQYELLSKEEYLKCTLIINQRRNEQK |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl23965. Profile Description: Bacterial protein of unknown function (DUF910). This family consists of several short bacterial proteins of unknown function. |
Pubmed ID | 34061833 |
Domain | CDD:420120 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1562274 | 1562477 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1628093 | 1628293 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 2024555 | 2024758 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
4 | 1550206 | 1550406 | - | NZ_LT906460.1 | Staphylococcus simiae |
5 | 1376090 | 1376293 | + | NZ_AP018587.1 | Staphylococcus caprae |
6 | 883260 | 883463 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
7 | 2022714 | 2022917 | + | NZ_CP033732.1 | Staphylococcus hominis |
8 | 1224846 | 1225049 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
9 | 1275863 | 1276066 | + | NZ_LR134242.1 | Staphylococcus warneri |
10 | 153083 | 153286 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
11 | 1314845 | 1315045 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
12 | 514778 | 514978 | + | NZ_CP018199.1 | Staphylococcus succinus |
13 | 1330016 | 1330216 | + | NZ_CP064056.1 | Staphylococcus lloydii |
14 | 1430653 | 1430853 | - | NZ_CP013114.1 | Staphylococcus equorum |
15 | 1282604 | 1282801 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
16 | 1463476 | 1463676 | + | NZ_CP018776.1 | Staphylococcus condimenti |
17 | 245740 | 245943 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
18 | 1632406 | 1632606 | - | NZ_CP033460.1 | Staphylococcus debuckii |
19 | 479663 | 479857 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
20 | 1361276 | 1361440 | + | NZ_CP008724.1 | Staphylococcus xylosus |
21 | 1355618 | 1355821 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
22 | 7973 | 8176 | - | NZ_CP020773.1 | Staphylococcus lutrae |
23 | 1091344 | 1091535 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
24 | 1066880 | 1067071 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
25 | 1164116 | 1164316 | + | NZ_CP065712.1 | Staphylococcus auricularis |
26 | 1125688 | 1125891 | + | NZ_LT906464.1 | Staphylococcus muscae |
27 | 1391909 | 1392112 | + | NZ_CP008747.1 | Staphylococcus hyicus |
28 | 1986686 | 1986856 | - | NZ_CP027770.1 | Staphylococcus felis |
29 | 1182322 | 1182513 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00482.25 | 0.72 | 21 | 2938 | same-strand | Type II secretion system (T2SS), protein F |
2 | PF00437.22 | 0.72 | 21 | 1990 | same-strand | Type II/IV secretion system protein |
3 | PF00753.29 | 1.0 | 29 | 1312.0 | same-strand | Metallo-beta-lactamase superfamily |
4 | PF01910.19 | 1.0 | 29 | 984 | same-strand | Thiamine-binding protein |
5 | PF00480.22 | 1.0 | 29 | -3 | same-strand | ROK family |
6 | PF01694.24 | 1.0 | 29 | -10 | same-strand | Rhomboid family |
7 | PF01812.22 | 1.0 | 29 | 1454 | same-strand | 5-formyltetrahydrofolate cyclo-ligase family |
8 | PF00471.22 | 0.86 | 25 | 2179 | same-strand | Ribosomal protein L33 |
9 | PF00905.24 | 0.76 | 22 | 2457.5 | same-strand | Penicillin binding protein transpeptidase domain |
10 | PF03717.17 | 0.76 | 22 | 2457.5 | same-strand | Penicillin-binding Protein dimerisation domain |
11 | PF02777.20 | 0.69 | 20 | 4652.5 | same-strand | Iron/manganese superoxide dismutases, C-terminal domain |
12 | PF00081.24 | 0.69 | 20 | 4652.5 | same-strand | Iron/manganese superoxide dismutases, alpha-hairpin domain |