Result : EXP02304
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02304 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 2776771 |
| Right | 2776971 |
| Strand | - |
| Nucleotide Sequence | ATGATACTAGTAATGTTATCTCCATTATTAATCATATTCTTTATAGTGTTGTCTATTTTAGAAGAGCGTAAACGTACGAAGAAAAAGCAACTCGAGAAAGAAAAAGCAAATACACTAAATCAAAATACAAATGACACGGAAAGTTCAAATCAAGAGCCGTCATTGCAGCAGGATAAAGAACAAAAAGATAACAAAGGATAA |
| Sequence | MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQDKEQKDNKG |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2719286 | 2719486 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2680595 | 2680786 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00255.21 | 1.0 | 2 | 5879.0 | same-strand | Glutathione peroxidase |
| 2 | PF02687.23 | 1.0 | 2 | 2453.0 | same-strand | FtsX-like permease family |
| 3 | PF00005.29 | 1.0 | 2 | 1701.0 | same-strand | ABC transporter |
| 4 | PF02463.21 | 1.0 | 2 | 1701.0 | same-strand | RecF/RecN/SMC N terminal domain |
| 5 | PF02518.28 | 1.0 | 2 | 679.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF00072.26 | 1.0 | 2 | 30.5 | same-strand | Response regulator receiver domain |
| 7 | PF00486.30 | 1.0 | 2 | 30.5 | same-strand | Transcriptional regulatory protein, C terminal |
| 8 | PF00245.22 | 1.0 | 2 | 197.5 | opposite-strand | Alkaline phosphatase |
| 9 | PF12802.9 | 1.0 | 2 | 1903.5 | same-strand | MarR family |
| 10 | PF00756.22 | 1.0 | 2 | 2604.5 | same-strand | Putative esterase |
| 11 | PF10425.11 | 1.0 | 2 | 3482.5 | same-strand | C-terminus of bacterial fibrinogen-binding adhesin |
| 12 | PF17961.3 | 1.0 | 2 | 3482.5 | same-strand | Bacterial Ig domain |
| 13 | PF04650.19 | 1.0 | 2 | 3482.5 | same-strand | YSIRK type signal peptide |
| 14 | PF00746.23 | 1.0 | 2 | 3482.5 | same-strand | LPXTG cell wall anchor motif |
++ More..