Result : EXP02303
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02303 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1862712 |
| Right | 1862909 |
| Strand | - |
| Nucleotide Sequence | AATATGATAAGTGTTAGATACAACCCTATGAGGGTTATAAATAGTACTGGAATTGTAATGATGATACCAGTTTTAAAGTATGTGCCCCAAGAAATCTTAACATCTTTTTGTGTTAAGACGTGTAACCACAGTAATGTAGCTAAAGAGCCTATCGGTGTAATTTTTGGACCTAAATCAGAACCGATAACATTCGCATAA |
| Sequence | NMISVRYNPMRVINSTGIVMMIPVLKYVPQEILTSFCVKTCNHSNVAKEPIGVIFGPKSEPITFA |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 34061833 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1805873 | 1806043 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 989826 | 990020 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 3 | 268262 | 268456 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 4 | 2494398 | 2494592 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 5 | 36739 | 36933 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 6 | 67481 | 67675 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 7 | 559672 | 559866 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 8 | 1154539 | 1154733 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 9 | 1692456 | 1692620 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 10 | 900874 | 901038 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 11 | 2544483 | 2544668 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 12 | 1422389 | 1422550 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 13 | 2078499 | 2078663 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 14 | 1002014 | 1002208 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 15 | 145922 | 146086 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 16 | 470462 | 470656 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 17 | 1987803 | 1987967 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 18 | 2632399 | 2632563 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 19 | 658818 | 658979 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 20 | 3024019 | 3024216 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 21 | 5179840 | 5180004 | + | NZ_CP009288.1 | Paenibacillus durus |
| 22 | 1355840 | 1356004 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 23 | 3093530 | 3093694 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 24 | 1422037 | 1422219 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 25 | 231313 | 231477 | + | NZ_CP011937.1 | Bacillus velezensis |
| 26 | 3808890 | 3809051 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 27 | 4533173 | 4533337 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 28 | 4369998 | 4370162 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 29 | 1926460 | 1926621 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 30 | 4882327 | 4882554 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 31 | 5133765 | 5133941 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 32 | 276909 | 277070 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 33 | 3373138 | 3373302 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 34 | 2995179 | 2995343 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 35 | 919477 | 919665 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 36 | 883662 | 883826 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 37 | 448940 | 449104 | + | NZ_CP021082.1 | Deinococcus ficus |
| 38 | 71119 | 71331 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 39 | 2928712 | 2928876 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 40 | 434808 | 435002 | + | NZ_CP024199.1 | Thalassospira marina |
| 41 | 790371 | 790535 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 42 | 129694 | 129858 | - | NC_015170.1 | Deinococcus proteolyticus MRP |
| 43 | 2542578 | 2542742 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 44 | 256631 | 256795 | + | NC_008010.2 | Deinococcus geothermalis DSM 11300 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01022.22 | 0.82 | 33 | 1111 | opposite-strand | Bacterial regulatory protein, arsR family |
| 2 | PF12840.9 | 0.9 | 36 | 1130.0 | opposite-strand | Helix-turn-helix domain |
| 3 | PF02040.17 | 0.93 | 37 | -164 | opposite-strand | Arsenical pump membrane protein |
| 4 | PF03600.18 | 0.93 | 37 | -164 | opposite-strand | Citrate transporter |
| 5 | PF01451.23 | 0.78 | 31 | 57.5 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
++ More..