| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02302 |
| NCBI Accession ID | NC_009641.1 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman |
| Left | 1473903 |
| Right | 1474097 |
| Strand | - |
| Nucleotide Sequence | GTGTCGCGTATTTTAACTTTTTCAGAGCAAAATGCACTCGCGAAAATAGATGATTTAATGAATACTTATTGCAATCAATGTCCAATCAAAACTCGTCTGCGTAAATTAGAGGGGAAAACGAAGGCGCATCATTTTTGTATCAATGAGTGTTCAATAGGGAAAGAAATAAAACAATTAGGAAATGAACTTCAATAG |
| Sequence | VSRILTFSEQNALAKIDDLMNTYCNQCPIKTRLRKLEGKTKAHHFCINECSIGKEIKQLGNELQ |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam10782. Profile Description: Zinc-finger. This bacterial family of proteins is a zinc-finger domain of the C2HC type with an additional cysteine. |
| Pubmed ID | 34061833 |
| Domain | CDD:402422 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 64 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1475102 | 1475296 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 2 | 1373947 | 1374141 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 1411943 | 1412137 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 402521 | 402715 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 5 | 1384028 | 1384222 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 6 | 1507215 | 1507409 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 7 | 2116064 | 2116258 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 8 | 757736 | 757930 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 9 | 1097724 | 1097918 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 10 | 1402213 | 1402407 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 11 | 25199 | 25393 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 12 | 1920756 | 1920950 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 13 | 657058 | 657252 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 14 | 1266651 | 1266836 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 15 | 1329020 | 1329214 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 16 | 1464585 | 1464779 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 17 | 1446466 | 1446660 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 18 | 1890676 | 1890870 | - | NZ_CP027770.1 | Staphylococcus felis |
| 19 | 1491403 | 1491597 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 20 | 385304 | 385489 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 21 | 1065400 | 1065585 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 22 | 1212261 | 1212455 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 23 | 1538411 | 1538605 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 24 | 1557839 | 1558033 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 25 | 2427745 | 2427903 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 26 | 1213665 | 1213859 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 27 | 1298729 | 1298923 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 28 | 1223005 | 1223199 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 29 | 950128 | 950322 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00186.21 | 0.97 | 28 | 3120.5 | same-strand | Dihydrofolate reductase |
| 2 | PF00303.21 | 1.0 | 29 | 2109 | same-strand | Thymidylate synthase |
| 3 | PF06491.13 | 0.97 | 28 | 1215.5 | same-strand | Disulphide isomerase |
| 4 | PF13769.8 | 0.93 | 27 | 278 | same-strand | Virulence factor |
| 5 | PF08712.13 | 1.0 | 29 | 15.0 | same-strand | Scaffold protein Nfu/NifU N terminal |
| 6 | PF13646.8 | 0.93 | 27 | 278 | same-strand | HEAT repeats |
| 7 | PF02592.17 | 1.0 | 29 | 251 | opposite-strand | Putative vitamin uptake transporter |
| 8 | PF13456.8 | 0.97 | 28 | 1184.0 | opposite-strand | Reverse transcriptase-like |
| 9 | PF02739.18 | 0.86 | 25 | 2250 | same-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
| 10 | PF01367.22 | 0.86 | 25 | 2250 | same-strand | 5'-3' exonuclease, C-terminal SAM fold |
| 11 | PF00350.25 | 0.72 | 21 | 3083 | same-strand | Dynamin family |
| 12 | PF01926.25 | 0.72 | 21 | 3083 | same-strand | 50S ribosome-binding GTPase |